Detailed information on CNT30596772


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30468973Oryza meridionalisSaccharum spontaneum6.727.2984.93146forward
CNT30338547Oryza meridionalisEragrostis tef5.4123.5588.14118forward
CNT30105380Oryza meridionalisOryza longistaminata24.0877.5597.33525forward
CNT30102896Oryza meridionalisOryza rufipogon6.768.2297.95146forward
CNT30117360Oryza meridionalisOryza nivara21.8325.9797.27476forward
CNT30558037Oryza meridionalisPanicum hallii5.8323.4384.25127forward

Expression of CNT30596772

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MVDTYLAGEFVSYGQILCWSYFTSSFIGIMLAFNQ*

>peptide 2 (94 aa)
PLPAARCRILGPPLLRPPDRGFYWRRRAQRPADHGRGRGDQICNWGQQARGGNCIICKKLLAEDHTDDILASYAVAASSLLPPVAKASKMKTLN*

>peptide 3 (77 aa)
MLHNSHCNELRKRSLKRVMSLAEHIVHVFCFSQKVKWGKNWSSDCPKYYEIPLDVPLISQYVVLIYVLQAHNRSNFQ*

>peptide 4 (35 aa)
MGAKVPLYDKYFAVIQTILLFSFVFLIVHHFLIIV*

>peptide 5 (31 aa)
MLNNKVNLTRKAFVSDSNNLRLRSTYPIQQL*

>peptide 6 (55 aa)
PRYPPRDAASSAPLFSARLIEGFTGDAARSDQPTTDEDEGIRYAIGGSKLEVAIA*

>peptide 7 (59 aa)
MMSLKNPIVKLRLLPYTPHQKTATTGTTRHASSYNHAVTRIQASKALGRLSFRRCQHNA*

>peptide 8 (36 aa)
MVTCNCYLILLSPILVCNLNYNWMRVKTVKNQWGGL*

>peptide 9 (45 aa)
MIHLQQPPIYHHDESEEPDCQVTPSTIYSPPKNSYHWYYKTCLKL*

Sequence

>CNT30596772
CCCCGCTACCCGCCGCGCGATGCCGCATCCTCGGCCCCCCTCTTCTCCGCCCGCCTGATCGAGGGTTTTACTGGAGACGCCGCGCGCAGCGACCAGCCGA
CCACGGACGAGGACGAGGGGATCAGATATGCAATTGGGGGCAGCAAGCTAGAGGTGGCAATTGCATAATTTGCAAGAAATTGTTGGCTGAAGATCATACC
GATGATATTCTTGCAAGTTATGCAGTTGCTGCCTCAAGCTTGCTGCCTCCTGTTGCCAAAGCTAGTAAAATGAAAACATTAAATTAATATAGCTGGACGG
TTTTGCTTGCAGCCTTATGTTCTTCTTTTCAGCTCATGAATTTCTATTTATCATAGATATAACATGCATAGTTAAAAGCTAGAAAGTGGCAACAACATTA
GTATGAGCTAGCAACACTTTTGAGTTTGTATGTTCTGAAAACGCATAAGGATTTCAGACTAGTGAAATTAAGTATTCTCTAGTCAAATATATTTGACGTT
GGGAGGACTAAACTTAGCTCTCCCAACATCAATTATATTTGACTGGAGGGAGTATTTGGGTTTTTATTTTTTAAATTTCTGGTTCTACATGTTTGAATTG
TCAAATCGGTAGTGGTTCCTTTGACACCATTTATCATCCTTCTTTAATTAACTGGAATATTCATCTTATGAACTACTCTGATAATATTCTTCTTAATTAC
ATCAATTTTTTCCTTTTCCATCTTTTCTGATGAGAACTATTCTTTTCGAGCTTTCTTGTTGGGTGCTTGCATTTACTTGCTATTTTCAGCTGTTTCACAA
AAGCATATGAAAATACTCCCACTTCTCTACGGAATGAATTAAGATGACAGAACACAGAAATCTTTGTACAGTAAATTAAACATTGGGGTGGGGGTTGAAG
TAGCAGAAAACCCATAGCTTGTGGATTGTTGGCCTTGTGGCACATAATCTTCGATTTTATGGTCAAAGTTTTGACAAAACCTAATCCATCCAAACCCTAA
GTCTCATGGGGGCCAAGGTACCACTTTATGATAAATATTTTGCAGTGATCCAAACCATCCTTTTGTTTTCCTTTGTTTTTTTAATTGTACATCATTTCTT
AATAATAGTATAGAATCAAGTTTAAAATGTCCTATGGTAACTTGTAATTGCTATTTGATCTTGTTATCACCTATTCTGGTTTGCAACCTAAATTATAACT
GGATGAGAGTCAAAACAGTTAAGAACCAGTGGGGAGGTCTCTAGCAGGCAACAGTCTCTTCATGCTGAACAATAAAGTGAACTTGACCAGAAAGGCATTT
GTTAGTGATAGTAACAATCTTAGGTTGAGATCAACATATCCAATCCAACAATTGTAACCTACTTTGTACATATGCTCCATAACAGTCACTGCAATGAGTT
AAGAAAAAGGTCACTGAAACGTGTAATGTCTCTTGCAGAACATATAGTACACGTCTTTTGTTTCAGTCAGAAAGTTAAGTGGGGCAAAAACTGGAGTAGT
GATTGCCCAAAATATTATGAAATACCTCTCGATGTACCTTTGATTTCACAATATGTTGTGCTAATTTATGTTTTACAGGCACACAACAGATCCAACTTTC
AATGACATGTTTCGTTTAGCTACAATAATTGTTGGGTAGCTGTAGAGCAGCACATGGTAGACACATATTTGGCAGGTGAATTCGTGTCATATGGACAGAT
CTTGTGTTGGAGCTATTTTACCAGTTCTTTCATTGGAATAATGCTAGCATTTAATCAGTGATATAGGAGATGATTCACCTTCAACAACCTCCCATTTATC
ATCATGATGAGTCTGAAGAACCCGATTGTCAAGTTACGCCTTCTACCATATACTCCCCACCAAAAAACAGCTACCACTGGTACTACAAGACATGCCTCAA
GTTATAACCATGCTGTTACGAGGATCCAAGCATCCAAAGCACTTGGAAGATTAAGCTTCAGGCGTTGTCAACATAATGCATAATTAGTTGCATACTTGCG
TTGTAAGTTGTAACAGGGAGCTTTGCTCCAGTAACTCAGTATCATTGTCCAATAAATCTCACTTAGAAGTTAGAATGTACATTAGGTGTGTGGTCGACTC
AGCGCTTAACATGATGTAATCAGTTGGAACTCAATTCAGTACCTGTTCCTATTAAATTGATTTATTAAACGTTTGTTCAT