Detailed information on CNT30596733


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001560, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30117489Oryza meridionalisOryza nivara99.0647.6193.56528forward

Expression of CNT30596733

Peptides detected in this lncRNA

>peptide 1 (53 aa)
MAGLRKGKRDGHAQHQHLHHQRDIATSSRITYEVHDNDLARVESKLPVFDAKYD

>peptide 2 (31 aa)
FVSRLASLVRSSLGPARYLTLNHYSTLHSLI*

Sequence

>CNT30596733
CGTTTGTGTCTAGGCTCGCGTCTCTAGTACGTTCTAGCCTAGGACCAGCACGGTACTTGACTTTGAACCATTATTCAACTTTGCATTCTCTGATTTGAAC
CATTGCTTCCCTTTGCTACATATTTAAGCCAACCTAGAGCTCCACAGATTTGATTGCAGCTGTACAGCAAGTGTTTGCCAAGGCATCGATACATCCAAAC
TCCATTGGGGTGCTTGGTTGAGTCGGTGTACGTCACCATTCCGCTTGCTTTGGTAAGAACTTGTAAGAGCTTGGTGAAAAGCTTGAGTGTGTGTGATATT
TCAGCTGCCACTACCTAGTAGTTGATAGGAGCGTGCATATTCTTGTGTATGTTTCTTGTTTGCTACTAACCATGGCAGGATTGCGCAAGGGGAAACGAGA
TGGTCATGCTCAACATCAACATCTTCACCATCAACGAGATATAGCGACTTCTTCACGCATCACATATGAGGTACATGATAATGATCTTGCAAGGGTAGAA
TCTAAATTGCCAGTTTTTGATGCTAAGTATGAT