Detailed information on CNT30596705


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30104562Oryza meridionalisOryza rufipogon10026.0497.26219forward

Expression of CNT30596705

Peptides detected in this lncRNA

>peptide 1 (72 aa)
EENYRDYLRWYLPRTRARVTFTPNAPEPHVAAVTDAYPTHRDRDYFVGADAARDISADITAVQVRLNRGLHLT

Sequence

>CNT30596705
GAGGAGAACTACCGTGACTACCTTCGCTGGTACCTTCCTCGCACTCGTGCGCGTGTGACCTTCACTCCAAACGCCCCAGAGCCGCACGTTGCCGCTGTCA
CGGACGCGTATCCCACGCACCGTGACCGAGACTACTTCGTGGGGGCTGATGCCGCACGGGATATCAGTGCCGATATCACCGCAGTCCAAGTGAGGTTGAA
CAGAGGTTTGCACTTGACT