Detailed information on CNT30596646


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6Z4N6|40G2_ORYSJ, E-value = 1e-32

BLAST vs NONCODE:
NONZMAT000139, E-value = 6e-47

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30520246Oryza meridionalisSetaria italica29.5823.1989.91218forward
CNT30221546Oryza meridionalisHordeum vulgare28.6392.5492.42211forward
CNT30370630Oryza meridionalisOryza glumipatula44.78100.6196.36330forward
CNT30102506Oryza meridionalisOryza rufipogon87.52100.1697.83645forward
CNT30576982Oryza meridionalisOryza barthii90.9199.5598.06670forward

Expression of CNT30596646

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MLFTMRTQRKPWPTSLLSVHSTDSSRYSGL

>peptide 2 (31 aa)
MQRSSNPSVRISDFFRGSEGNQSISDGIVHY*

>peptide 3 (85 aa)
MQLPLPRNLCRCKEAAIQVSESLISSEDPKEINRSAMALCIISSGTYTRGGSSSAGCHPRTTSTARSRCHRGCRRDPCRHGRRPS*

>peptide 4 (34 aa)
MSCIRFLNHMAPPPPLHHPLFHLIAITGSQKATH*

>peptide 5 (37 aa)
MEGVQVEVDVVHHADAAEAMADVLALRPQHRLVQVLRV

Sequence

>CNT30596646
CCAGTAGCACGCATTTTTTTTCAGCACCATTAACACGTCACAAACAGAAGAAGGGGAAACAGGGTGGAGACAAATGAGCCATTCATAATTCATCCATTAG
GCATACGAAAAGTAGAGAGTACAGGGGAAAGCAAGATGAGTTGCATCAGATTTCTGAATCATATGGCCCCTCCTCCACCACTCCATCACCCACTGTTTCA
TCTCATAGCAATCACTGGCTCGCAAAAGGCCACACACTGACACAAACTCGAGGACGGACGGACACCATTGATTGCCATACTCCGATCGATCGAACGAACG
AACACGGTCTTATTTCGGTAGCAGATCGATCAAATTATTAGCTAGAGTAGAAGCAGAGCAGACGCGACGACGATGGCAATGCAATGCAGCTCCCGCTCCC
CCGGAATCTCTGCAGATGCAAAGAAGCAGCAATCCAAGTGTCAGAATCTCTGATTTCTTCAGAGGATCCGAAGGAAATCAATCGATCAGCGATGGCATTG
TGCATTATTAGCAGTGGAACTTACACCAGGGGAGGATCTTCCAGCGCTGGTTGTCACCCTCGCACCACTTCCACAGCACGATCTCGGTGCCATCGTGGAT
GCCGCCGTGATCCTTGTCGCCATGGAAGGCGTCCAAGTTGAGGTAGATGTTGTTCACCATGCGGACGCAGCGGAAGCCATGGCCGACGTCCTTGCTCTCC
GTCCACAGCACCGACTCGTCCAGGTACTCCGGGTTGA