Detailed information on CNT30596602


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695053Oryza meridionalisOryza sativa52.8628.9188.03259forward

Expression of CNT30596602

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MWLGESGKAKAKAPPPKAKESTSKIQRKMW*

Sequence

>CNT30596602
CGGGCAAAGATGGAATGATACAATGAATCAATGATGATGATGACAGCAACATAAAATAAATTAAAAGTAGATGATCTCAGTGGTACAGTACAAGGGCGGG
CAGGCAGCAGCTAGCAGAGTCATATCGTGGGCGTAGCAGAGAGAAGAAGAAGAAAGAAACAAAAGAATCCGAGGCATGGCGATCGCTCAATCATCAAATG
TGGTTGGGAGAGAGTGGTAAAGCCAAAGCCAAAGCCCCTCCTCCCAAAGCCAAAGAATCGACAAGCAAAATACAGCGCAAAATGTGGTGAGCACCGGCCG
CTGCCATCTGCGTCGTCGTCGTTGCTCACGTCGTTGCACGACGCCGTTTGCTTAGGCGAGGAGGGCGACGAGGCGGCGGGGGCCTTAGCCTTCTTGGAGT
GCTTGGGGGACTCGGCGACGGCGACGGGGGCCGGGGCGGGGGCCTTGGAGCTCTTCTTCTTCTTCTTGGATGGCGGGGAGGGCTTCTTCT