Detailed information on CNT30596505


BLAST search results

BLAST vs Swiss-Prot:
sp|P20698|PRO28_ORYSJ, E-value = 1e-16

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30102349Oryza meridionalisOryza rufipogon69.3486.1396.37441forward

Expression of CNT30596505

Peptides detected in this lncRNA

>peptide 1 (50 aa)
NHSNIHVIFIYSYEQPNTIPNFHYMTHTIMCDTLFIQIYMLIHTTKNRND*

>peptide 2 (73 aa)
MIACTMVQIAWQPYCCAISLICRQHCCRITWQLLSCSLCDCSQGRLTGLHCCLTNSLHEFMIGCMNGCCWHCP*

>peptide 3 (62 aa)
SFKYPCNFHLFIRTTKHYSKFPLHDTHDNVRHFIYPNIYADTHYQEPQRLVATMHGVLQYLG*

Sequence

>CNT30596505
AATCATTCAAATATCCATGTAATTTTCATTTATTCATACGAACAACCAAACACTATTCCAAATTTCCATTACATGACACACACGATAATGTGCGACACTT
TATTTATCCAAATATATATGCTGATACACACTACCAAGAACCGCAACGACTAGTAGCAACGATGCATGGAGTGTTGCAGTACCTAGGATAGACACCACAC
ATGGAGGGCAAGTTGAGAGCCACCTGGGCCTGGGCCTGAGCTTGGGGCACACCAAATAAGTTAGCATCTAATTGCACCTGCTGCATGATCGCCTGCACCA
TGGTGCAAATAGCCTGGCAGCCATATTGCTGCGCCATCAGCCTCATCTGCCGACAGCATTGTTGTCGCATCACCTGGCAGCTGCTCAGTTGTAGCCTGTG
TGACTGCTCCCAAGGTAGGCTCACTGGGCTGCACTGTTGCCTCACGAACTCATTGCACGAGTTCATGATCGGTTGCATGAACGGCTGTTGTTGGCATTGC
CCATAGGTGCAAGCATCAAACTGTGCCGAGGCGTTGCTCGCTGCGAGGGCGAGGAGAGAGAGGATGACAAAGATCTTCATGGCTATGTGATGGATGCTAG
AGAACTCTTATAACGTTTTGATGTTTAAGATTTTTC