Detailed information on CNT30596491


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30102026Oryza meridionalisOryza rufipogon58.2122.5883.99606forward

Expression of CNT30596491

Peptides detected in this lncRNA

>peptide 1 (47 aa)
MDISICDGIKGPNNALHFLLFEVLHVLLVNAVIIWQNKWQQFPSVSN*

>peptide 2 (61 aa)
MICSLLLLITSTCLKSNYFVFLAWFLFSISLKVGLASLCNSVTTVLPHMSDLFACYGHQHL*

>peptide 3 (78 aa)
PPAWSWPGSAKPELPLMDFSPFGHDFSVHCFAFPVLSPSLSTMVIFLTGDLNDLFTSPSDYIDLFKIELFCISCLVSL*

>peptide 4 (46 aa)
MAICWRWRRRRWTEVFITSMIYHEHANPIGWFMHIDRERERERERD*

Sequence

>CNT30596491
GGCCTCCTGCCTGGAGTTGGCCGGGCAGTGCGAAACCTGAGCTGCCATTGATGGATTTTTCACCATTTGGTCACGATTTTAGTGTACATTGCTTTGCCTT
CCCTGTTCTTTCTCCTTCTCTATCCACCATGGTGATTTTTTTAACGGGAGATTTGAATGATTTGTTCACTTCTCCTTCTGATTACATCGACCTGTTTAAA
ATCGAATTATTTTGTATTTCTTGCTTGGTTTCTCTTTAGCATTTCACTGAAGGTTGGCTTGGCATCTTTGTGTAATAGTGTTACAACTGTCCTACCTCAC
ATGTCTGATTTGTTTGCGTGCTATGGACATCAGCATTTGTGATGGGATAAAGGGGCCAAACAACGCATTACATTTTTTATTGTTTGAAGTTTTACATGTA
CTTTTGGTCAATGCTGTGATAATCTGGCAGAACAAATGGCAACAGTTTCCTAGTGTTTCAAATTAATTTCTCAGCAAAACACTTTCCTTTTGTTTTGTTG
CATTTCATTTGTATGTTATCTATTGAATGGCTGTGATGAATTTGCTGCCCTTTGGCGGTGTTGGGGGAATCTATTAACACTGCCTGAGTTGGTTCCGTGC
TAAATTGATCAGCTAGTCGCCAAACTAGGAGGGCTTGCTTTGCAGCAAGTTACCAGTTCATGGCTATTTGCTGGCGGTGGCGGCGGCGGCGGTGGACTGA
GGTTTTTATTACTTCTATGATCTATCATGAACATGCCAATCCCATTGGATGGTTCATGCACATAGATAGAGAGAGAGAGAGAGAGAGAGAGAGAGATTGA
GACAGTTTTATTGCATTGTCTGCTACAGTGGCATGATCCAACTTTGGTGATTCACAATGGGGGTCCAATCTGAGCCATTCCATAAAGGTTTTCTAATTTA
AATTTCTAGCGTACATTGATTTCTTCGTCGTTTGTTTGTTGCACTTGCTTATCTGAAAGTTGTACTATTTACCTGCTGGTACTTTTGGGTGCTCCAGAAG
GCATATTTGTTTTCTTTTTTTTCAGACAACCCTCTTTTCTT