Detailed information on CNT30596484


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003896, E-value = 7e-44

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30556064Oryza meridionalisOryza glaberrima13.6627.2587.63493reverse complement

Expression of CNT30596484

Peptides detected in this lncRNA

>peptide 1 (41 aa)
MASKLQCDVDAHEGVRYQFPLLRNHISFRNNFLIKKCNAYQ*

>peptide 2 (38 aa)
MDQCYKHPTEASIFFPVQSKLLKIYKQILKYIMIVFEF*

>peptide 3 (35 aa)
MAITGHINYTRKICPKNKIRSYFLPYSMHVRNREH*

>peptide 4 (29 aa)
MSVAGVFSRGSLIFSRGSQIEVTNRYKYT*

>peptide 5 (62 aa)
MFFYPIMVTQHTSIHLWKCSRKPKTILLHFRKQHFSNTSVDSQKKYILNAVLSHGLNMKSHI*

>peptide 6 (51 aa)
MLQADLNFAAHTKRYGLNPILEITCKCSKIMEEKLVTTNLAKALVYIFTMG*

>peptide 7 (49 aa)
MKSLHDIIYFSKHCSQTSGYICCLTKMQMHCIYFLASKRNCNFMYYNIC*

>peptide 8 (45 aa)
MYMCVTYINFILKLRRIERHSEGIYFHLFIYLLEGREGNYKYQNI*

>peptide 9 (63 aa)
MYNFHPIFNCMDELSDISVHQGMHMRQQRRQDCIAARSIRWQEFYNKKLIATSQCIQRKCTTI*

>peptide 10 (73 aa)
MEIKNRYFYMKTKPKFTLKCMADFRKIVIGANEDNLITSYIDQCRPMQSVKPSTPKAHEFLEVLSMHALCICV*

>peptide 11 (83 aa)
MNQYGNNWSYQLHKKNMPKKQDKKLLFTLFNACEKQRTLTGNSRFWAQVFDQWGHVQWNGSVLQTSHRSFNFFSRTKQVTENL*

Sequence

>CNT30596484
TGTCTAAAGCATTGGCATCTATATATAACTCATTAGAGTTAAATTCATAACATGTATAATTTCCACCCAATTTTCAACTGTATGGATGAGCTATCTGATA
TTTCAGTTCATCAAGGCATGCACATGAGACAACAGCGGCGCCAAGATTGCATCGCTGCTAGGTCTATAAGATGGCAAGAGTTTTACAACAAGAAGCTGAT
AGCCACTTCTCAGTGTATTCAAAGAAAATGTACTACAATATAAGTCAATGTTTGTGAACGTTGTTACCATGGCAACAACAATCAACTTAATTCAGTAATA
CTTCGCAATTGTTGGTTAACCATGTGACGTGATCCAAGCTGAACGAGATGCATACGCTTGACTTGGAGATTGGGGAGCTTGGCTGAGAGGAAGGCGGATC
ACGAGCAGTCAGCGAGCAATACTCGACTCCCTGTTAAATGGAATCTGAAACTTCAGTCCATATGAAACATCAGTCCTTTTTAGCCTAAGGGGTCGCCAAA
ATAAATTCCATTGACTACTTATCTTATCCATCCCTGGTTCATATAATATGTTTGAGAAGTTACTTTTTTAATGCACATCGTATCATCTTTATCTCTGGTT
CCCTAACATCATGTTCTTTTATCCCATAATGGTAACACAACATACAAGTATCCATCTCTGGAAATGTTCAAGAAAGCCCAAAACAATACTCCTACATTTT
AGGAAACAACATTTTAGCAATACCTCTGTCGATAGCCAAAAAAAATATATACTTAATGCAGTACTATCACATGGTTTGAATATGAAATCACATATATAAA
TCTATACTAATTCCTCTCTATTTTCTAAAAATCAATGTATTATCGACATGGTTTTCACAGTACACCTAATCTATTTTCAGAACATGGATAAGTTAGCACA
GAATTTGTAAGAACTGCATCAGAAACCAATTAATTCTTACCCCTAATAAGAGTAGCATTACTACAAGAAATTTAGTACAGTAAAGGTACTCATAGCACGC
TACTCATCGAGAAGAACAAGTGCAAAATACATGCTCCTATGATCCTATCAATCACACAATGATACTCATAACGGTCACTAAAAAGAACAAGTATGGCAAT
ATCTTGAGATCAACCTAACTGAAAATGAACATCAACTATCATCAATGAACCAGTATGGCAATAACTGGTCATATCAATTACACAAGAAAAATATGCCCAA
AAAACAAGATAAGAAGCTACTTTTTACCTTATTCAATGCATGTGAGAAACAGAGAACATTGACTGGAAACAGCAGGTTTTGGGCACAAGTCTTCGATCAG
TGGGGTCACGTGCAATGGAATGGATCAGTGCTACAAACATCCCACAGAAGCTTCAATTTTTTTTCCCGTACAAAGCAAGTTACTGAAAATTTATAAACAA
ATTTTGAAATATATCATGATAGTCTTTGAATTTTGAGAAGCCTTGCTAGCTGACATCTTAACAAGAAGGAAAATACCCCTATGGAAATAAAAAAATTACT
CTAGAAAATAAAAAATTTACTCTAGAAAATACCTCACAATCATAACTTTCCTATTGAATGGAAATAAAAAATAGGTATTTTTACATGAAAACCAAACCAA
AATTTACTCTAAAATGCATGGCAGATTTCAGGAAAATAGTAATCGGTGCTAATGAAGACAATTTGATCACCTCTTATATAGACCAATGCAGACCAATGCA
GTCAGTAAAACCATCGACTCCCAAAGCTCATGAATTCTTGGAGGTACTCTCCATGCATGCTCTATGTATATGTGTGTGACCTACATTAATTTCATCTTAA
AACTTAGGAGGATTGAAAGGCATTCTGAAGGCATCTATTTTCACTTATTTATTTATTTATTAGAAGGTAGAGAAGGAAACTACAAATATCAAAATATATG
AGCCTAAATATTTTGATATGAAAATGAAAATGTAGTACCAATCTGAAATCAATCTTTTCCTAATTAAAAAATGAGTACAAGAAAACCTTAAGGCGGCAAG
ATGGCCTCAAAATTACAATGTGATGTGGATGCGCATGAAGGAGTGCGATATCAGTTTCCATTATTAAGAAATCACATTAGTTTTCGCAACAACTTCTTAA
TAAAAAAATGTAATGCATACCAATAGATTCCAGCAAATAGGAGACAGTCAGCCAATAACAGGTACCCACTGATATTAATTGCTGATTAAAGTAACCTGAG
TTTCACTATCCACCAACTTTGCATATCAAGGTTGATAAGGGGGTGACTAGGGATCGGTCGCCCGATCGAAAACTTCAAAAATCGGGCGTTGACGTCAGCA
TGATGTCAGCGCCCGATTTACGTGCAAAACTACTTTAAACTGATTTTTACTTATCCAAATTATGATCCGACTGCACCATTAAATTCGTTGCAATTAAATC
TTCGTATATTCCGATGAAAAATTTTAGCTTATTATTGTATTATTTTTGAAAAAATTAGATTGACTGCATGAAAACATCACGATTTGAATACAAAACACAA
GCTAAAAACTCATAAGATAGTCTTGGTAAAAAAAAGAGATGAAATCTTTACACGATATAATCTACTTTTCAAAACATTGCTCACAAACCAGTGGATATAT
TTGTTGTTTAACAAAGATGCAAATGCACTGCATTTACTTTCTAGCAAGTAAAAGGAATTGCAATTTCATGTACTACAATATATGCTAAAACTTTTTTAAA
AAAAGGGGCTCAATTAATGCACCAATTTCAGTTAGCCCTATTTTGACAGCAGATGAGTGTAGCTGGGGTATTCAGTAGAGGCTCCTTGATATTCAGTAGA
GGAAGCCAAATAGAAGTCACAAATAGGTATAAATATACATGAACTCAAATTTGACATAGGCATTCGATTACCCCTAAGAAAAAAAAGTCAGATAAAATGG
AGTGAGCTACTCTATTAATATCAATTATTTGCCAATTTGTCAATCACTTAATCCGATTTAGTCACTCCAAGGAATACTAAACATCACAGTAATCTTATAA
TTTTTTCATGCCTAACTCCATATCACACATGCCATGAGCATCTGCCACTGACATGAAGGATGCAAATATCAGCAGAGAAAATAATGATATTTGCAATTTA
CAAATCATTAGTGTCATTAAGTGTGTTGAGAGAAAATAATTAATATAAACAGCAGGTACACTTAAATGTATCGCCAAGGGAACAACTTTGAAAAAGCTTC
CAAAAGCATATAACTAAACAATACGACAAGCCCAGGTACTGCACATTTTCTACCTAGAGAAAATTACTCTCGATCATTCATATTGCGTAGGTGCTAATAT
GGGTGATTAGGCACCTATCCTTGTCCTTTGTTTCAAGGCACCTTTACATATGTTTCATGCTACAAGCTGACTTGAATTTTGCTGCACACACTAAACGATA
TGGATTGAACCCAATCCTCGAAATTACATGCAAGTGCAGCAAAATCATGGAAGAGAAATTAGTGACAACTAACCTTGCCAAAGCTCTTGTTTACATTTTT
ACTATGGGATAAGCCCCAACAACGAATGGCATCCATGGTCCTTGCATTCTTCCAAAACACTTATATTTTTTTTATTAGAACTCAGCATAGGCAGCAATAA
TCAGGCCTCA