Detailed information on CNT30596454


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0DF13|SDH8A_ORYSJ, E-value = 4e-12

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30554175Oryza meridionalisOryza glaberrima41.8750.3288.54157forward
CNT30108390Oryza meridionalisOryza longistaminata68.2759.8187.5256reverse complement
CNT30102206Oryza meridionalisOryza rufipogon86.1395.2899.69323forward
CNT30116806Oryza meridionalisOryza nivara18.9320.791.5571forward

Expression of CNT30596454

Peptides detected in this lncRNA

>peptide 1 (57 aa)
VIERGRMIFMMSRQMKQPFINSEYPKTSWTDIINHFIQMINNQKLEIPSRHHNLLWR*

Sequence

>CNT30596454
CTGTAATTGAGAGAGGTAGAATGATATTTATGATGTCTCGTCAAATGAAACAACCTTTTATTAATTCAGAGTACCCAAAAACAAGTTGGACCGATATCAT
CAACCATTTTATACAGATGATTAACAACCAGAAACTAGAGATTCCTTCCAGGCATCACAATTTATTGTGGAGATAGTTTGAGTGAGCCAACGCCACTGGG
GTTATCTCTCTAGGAGAAAATTTGTTCTAGTGCAGGCCTTTAGCTAGTTCTTGCCCATTGCTGCTCTGTCCTGTTGCCTAAGCCTCTCACCTTCACGGCA
GAGATAGTTCTGGAATTTCTCCTGCCAGAATGCAAGAAATGGTTATACCTCCGATTAAGAGTAAACAAACTCACA