Detailed information on CNT30596449


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT005363, E-value = 4e-171

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30596449

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MSVSSVSTNRAVKVGWRARHCGLQMENSVQIKTLITLPSGHGIELGFF*

>peptide 2 (35 aa)
MSVSSVSTNRTVKVGWRARHCGMQMENSXXXXXXX*

Sequence

>CNT30596449
TGCAAATTAAAACCTTGATAACTTTGCCTTCCGGTCATGGAATCGAGCTAGGTTTTTTTTGACGGCTGCAGAATCACGGGCCTCACCCCTAGAGAGACTC
GATTTGGATAGTTGGACCCCCAGAGATTTTTCTAAAAATTACTTACCATAGGCCACGAAGCAGCGGTTGTTTCGGCGAAACGTCGAATATCTGAGGGTCC
ACAACTGGTTTTCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACCATAGGCCACGAAGCAGCGGTTGTTTCGGCGAAA
CGTCGAATATCTGAGGGTCCACAACTGGTTTTCAACGAGGTGGTTAGTATAGGGATGGCACGTAGGATGTTAGGGTGGATAGCTTAGACGATGTCGGTGT
CAAGCGTGTCGACTAACCGCACAGTTAAGGTAGGCTGGCGGGCGCGACACTGTGGAATGCAGATGGAGAATTCTNNNNNNNNNNNNNNNNNNNGTTAGGG
TGGATAGCTTAGACGATGTCGGTGTCAAGCGTGTCGACTAACCGCGCAGTTAAGGTAGGCTGGCGGGCGCGACACTGTGGATTGCAGATGGAGAATTCTG
TGCAAATTAAAACCTTGATAACTTTGCCTTCCGGTCATGGAATCGAGCTAGGTTTTTTTTGACGGCTGCAGAATCACGGGCCTTACCCCTAGAGAGACTC
GATTTGGAGAGTTGGACCCCCAGAGATTTTTCTAAAAATTACTTACCATAGGCCACGAAGNA