Detailed information on CNT30596434


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30101999Oryza meridionalisOryza rufipogon61.9639.2996.81627forward
CNT30576671Oryza meridionalisOryza barthii31.7220.6293.15321forward

Expression of CNT30596434

Peptides detected in this lncRNA

>peptide 1 (57 aa)
ILSLSLSRSLSPTLSLSPSLLSKPSLVLSLPHYSPSRPMGARKGGRLGVDRGRRRRL*

>peptide 2 (68 aa)
PLTLTLSFSLSHSLSLSLITLQAVPRSLSPPLLSKPANGGTEGGASRCRSGSETATLAAANWPGSADR*

>peptide 3 (47 aa)
MMFDWFVNRYLILYRTLFFLFFGLWPSYGCNCVCVWRMPLLRLTDEKL

>peptide 4 (51 aa)
MPCRSSLPHWRRPSSHRELPLPHRRRPFPSLSPHRWLLPISSGCRRRLTPR*

>peptide 5 (40 aa)
MDPFVDFIWVNLWLLCLPYGVVHPIWLCRTMKVWFWKVLP*

>peptide 6 (46 aa)
SSHSHSLVLSLPLSLSLPHYSPSRPSFSLSPITLQAGQWGHGRGGV*

Sequence

>CNT30596434
ATCCTCTCACTCTCACTCTCTCGTTCTCTCTCTCCCACTCTCTCTCTCTCTCCCTCATTACTCTCCAAGCCGTCCCTCGTTCTCTCTCTCCCCCATTACT
CTCCAAGCCGGCCAATGGGGGCACGGAAGGGGGGGCGTCTAGGTGTAGATCGGGGTCGGAGACGGCGACTCTAGCAGCGGCTAACTGGCCTGGCAGCGCA
GATCGGTGAGATGGGTGTAGGGGCAGCGCCGAGGAGATCGTCGTCGGTGGTGGTGCGGAAAGGTGCGATGGGCGCACGTTCTCACCAATAATCCATGCCG
TGCCGCTCATCTCTCCCCCACTGGCGACGGCCCTCCTCCCACCGTGAGTTGCCCCTCCCCCACCGGCGGCGCCCCTTCCCCTCCCTCTCCCCCCACCGTT
GGCTCCTTCCCATTTCGTCAGGGTGCCGACGCCGCCTCACTCCTCGCTAGATCCGGCTAGTCGGCGGCTCCCAGGCGGCGCAGTGGCTCGGGATTGGCTC
CTCCCACCAGCGACGGCCCTCCTCCCACCACGAGCTGCCCCTCCCCACCGGCGGTGCCCCTTCGTGTGCCTCCCCACTGGCGGCGTGACTACTGAAGAAG
CTGAAGAAGGAGGTCAAGATGGATATGTAAGAAGGGATTTGTCGATTGCTTTAGGCTGCAATGCTAATTTTGTTGGGGTGGATTGGAGTTCTCCCATGGA
TCCCTTTGTTGATTTTATTTGGGTGAATCTTTGGTTATTGTGTTTGCCTTATGGTGTTGTGCATCCGATTTGGTTGTGTCGAACTATGAAAGTCTGGTTT
TGGAAAGTGCTTCCATGAGATTAGATTATTGGTAGGATTGTCTCTCGGTGTAGTTCTAATACTAACTATGATGTTCGATTGGTTTGTTAATCGATATTTG
ATTTTGTATCGAACTCTTTTTTTTCTTTTTTTTGGGCTTTGGCCGTCGTATGGATGTAATTGCGTGTGTGTATGGAGGATGCCGCTTCTCAGATTGACGG
ACGAAAAATTAC