Detailed information on CNT30596432


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694005Oryza meridionalisOryza sativa45.9447.8490.61277forward
CNT30673640Oryza meridionalisSetaria viridis15.0923.9587.9191forward
CNT30226316Oryza meridionalisHordeum vulgare16.0922.8290.7297forward
CNT30443574Oryza meridionalisAegilops tauschii19.0720.9993.04115forward
CNT30663028Oryza meridionalisTriticum dicoccoides17.7422.7792.52107forward
CNT30141888Oryza meridionalisLolium perenne19.0721.6693.04115forward
CNT3012376Oryza meridionalisZea mays23.2224.5684.29140forward
CNT30368803Oryza meridionalisSorghum bicolor19.0722.0788.7115forward
CNT30370409Oryza meridionalisOryza glumipatula49.7538.5189.67300forward
CNT30102318Oryza meridionalisOryza rufipogon48.5947.2691.47293forward
CNT30583151Oryza meridionalisEchinochloa crusgalli45.2735.3281.32273forward
CNT30116988Oryza meridionalisOryza nivara27.3637.2595.76165forward
CNT30557529Oryza meridionalisPanicum hallii17.0849.2886.41103forward

Expression of CNT30596432

Peptides detected in this lncRNA

>peptide 1 (93 aa)
MVSPDLTVKSLGSNTSTPPLAPRSTSCAMAPPASMALAGAMEGMVTAAEERAAMVASVLYFFLVCVCVCVVLLWFSSSGAGVVVAINQSNDLSS

>peptide 2 (43 aa)
VELFVSLLLIIDTHLHTHKRKLRNRSSVRSIFAVDRSIYRIEP*

Sequence

>CNT30596432
CGTCGAATTGTTTGTCTCATTGCTATTGATAATTGATACACACTTGCATACACACAAGAGAAAACTGAGGAACAGATCATCGGTACGTAGTATATTCGCG
GTGGACAGATCGATATATAGGATAGAGCCATAGGAGGAGTAGCAAGCAAGATCTAGAATTGAGATTGAGAAGAAAGAATAATTAGTTGACAGTGACCTTG
CCGACCATCCCAGCTCCGGCGTGCGGCTCGCAGTAGAAGCCGTATGTGCCGGGGACGGTGAGCGTGACGGAGAAGGTCTCGCCGGGGGCGTTGAGGGAAG
CCGGCGTTGTTCTTGAACGTGATGGTCTCGCCGGACTTGACCGTGAAGTCGTTGGGCTCGAACACCAGCACGCCGCCATTGGCGCCGAGAAGCACCTCCT
GCGCCATGGCGCCGCCCGCGAGCATGGCGCTGGCGGGGGCCATGGAAGGGATGGTGACGGCGGCAGAGGAAAGAGCGGCCATGGTAGCTAGTGTATTGTA
TTTCTTCTTGGTCTGCGTCTGCGTCTGCGTAGTACTCCTATGGTTCAGCAGCAGCGGCGCCGGTGTAGTGGTTGCTATAAACCAATCGAATGATCTGAGC
TCG