Detailed information on CNT30596416


BLAST search results

BLAST vs Swiss-Prot:
sp|Q5Z6F0|TIP22_ORYSJ, E-value = 1e-29

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673906Oryza meridionalisSetaria viridis24.4517.5993.69111forward
CNT30521445Oryza meridionalisSetaria italica25.5512.7393.97116forward
CNT30618329Oryza meridionalisSesamum indicum22.478.2782.35102forward
CNT30223457Oryza meridionalisHordeum vulgare25.9939.691.53118forward
CNT30397893Oryza meridionalisTriticum turgidum27.7519.7896.03126forward
CNT30589165Oryza meridionalisMusa acuminata28.4128.1790.7129forward
CNT30543529Oryza meridionalisBrassica napus23.7911.3481.48108forward
CNT30553963Oryza meridionalisOryza glaberrima75.1148.5195.01341forward
CNT30443838Oryza meridionalisAegilops tauschii27.0925.5295.12123forward
CNT30256642Oryza meridionalisAvena sativa27.7524.4796.03126forward
CNT30136463Oryza meridionalisLolium perenne22.4713.9291.18102forward
CNT30229576Oryza meridionalisAnanas comosus27.5317.5685.6125forward
CNT3066802Oryza meridionalisLeersia perrieri25.7749.3789.74117forward
CNT30364799Oryza meridionalisSorghum bicolor27.9716.6994.49127forward
CNT30370544Oryza meridionalisOryza glumipatula75.1140.3195.89341forward
CNT30644098Oryza meridionalisCannabis sativa25.5541.4383.62116forward
CNT30101982Oryza meridionalisOryza rufipogon101.7684.7794.37462forward
CNT30576681Oryza meridionalisOryza barthii101.7679.5295.67462forward
CNT30114821Oryza meridionalisEutrema salsugineum25.5511.181.9116forward

Expression of CNT30596416

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MAKWVLRTRCWQRGRGRRTCTRTGRRGRRGCWRRR*

>peptide 2 (39 aa)
MLAPTMKPMAIGAMVPSDPFLGSAAVAYTVYTSPKVTMIS

>peptide 3 (33 aa)
MDRSSPKCHILATKAFFHLNQINPSQHILTRME*

Sequence

>CNT30596416
CTCGAATCAAATGAAATCTCACAATGAAACTCAACAGAAGTGTTCGATCTTAAACATGCATCTCATCCAACTTGCTCCACACTGATCACATTACAAATTA
ATCAAGAAGAAACTAAACATGGATCGATCATCACCCAAGTGTCACATCCTCGCAACAAAAGCCTTCTTCCATCTGAACCAAATCAATCCTTCACAACACA
TCCTCACAAGGATGGAGTGACCACCATTTTTATGCGTCTTGCCGATGGCGAAATGGGTGCTTAGAACTCGCTGCTGGCAACGGGGGCGTGGTCGCCGCAC
ATGTACACGTACCGGTAGACGAGGCCGGCGAGGATGTTGGCGCCGACGATGAAGCCGATGGCGATCGGCGCGATGGTGCCGAGCGACCCCTTCTTGGGGT
CGGCGGCGGTGGCGTACACGGTGTATACCAGCCCGAAGGTGACGATGATCTCCA