Detailed information on CNT30596399


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004001, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695692Oryza meridionalisOryza sativa18.2976.9590.8424forward
CNT30553221Oryza meridionalisOryza glaberrima78.9942.2890.281831forward
CNT30370734Oryza meridionalisOryza glumipatula73.8191.6989.071711forward
CNT30109481Oryza meridionalisOryza longistaminata79.5992.6290.461845forward
CNT30100733Oryza meridionalisOryza rufipogon74.4286.4789.971725forward
CNT30575011Oryza meridionalisOryza barthii77.4459.289.861795forward
CNT30117985Oryza meridionalisOryza nivara79.47100.1689.851842forward

Expression of CNT30596399

Peptides detected in this lncRNA

>peptide 1 (65 aa)
MSRRYSHPPGTLWGRGRVMFFTRLLLRGRGGDTRRSAVVGSFQPNPALPRPAPLPPLVLSATTFAP

>peptide 2 (69 aa)
LSPLSFSRFHSVPPTTATAQHLLAPPSPAVPRRSSPPPSRPPVAEPGLTAATRPQAEPSRARGRRKKRR*

>peptide 3 (42 aa)
MMQSQAFVIWPRIVVKDRFLWKIHPNTLQCDHTDIYGMPMAK*

>peptide 4 (43 aa)
LSSLFLSISLCAADHSHCAAPPSAAVAGGASAELATAFPTAGC*

>peptide 5 (47 aa)
MRKLRTPFSKEKTCTLCKASLFDHIAPIFAKICCLKSALLSIHDKHV*

>peptide 6 (60 aa)
MGCLWLSKLLSHGGWCVNGCGMPRMRRQSFTHLLPIMGVFLPLLWHGTSSRRHPQYFLSG*

Sequence

>CNT30596399
CTCTCTCCTCTCTCTTTCTCTCGATTTCACTCTGTGCCGCCGACCACAGCCACTGCGCAGCACCTCCTAGCGCCGCCGTCGCCGGCGGTGCCTCGGCGGA
GCTCGCCACCGCCTTCCCGACCGCCGGTTGCTGAGCCGGGCCTCACCGCCGCGACACGCCCTCAGGCTGAGCCGAGCAGAGCGAGAGGAAGGAGGAAGAA
GAGGCGCTGAGCCGTTGACGGCCGGGCCCCGCACCTCCCTCTCTCCCTCAAGCAGCTGACAAGCCGGGCCCGCGCATCCTTCCTCCCATCCATCACTGAC
AGCCCAAGTATGAGGAAGCTCCGGACACCATTTTCAAAGGAGAAGACCTGCACCCTGTGCAAGGCAAGCCTCTTTGATCACATTGCCCCTATATTTGCAA
AGATATGTTGTTTGAAAAGTGCATTACTTAGTATACACGATAAACATGTTTAGGTCTCCGATTGTTTATACAACCGACGGATCAATCTAGTAGTCGCACT
TATATTACATAGGTTGTTGTTTCCATACCTTTGATAGCTCCACAAATGTTTACACTGGTATCGTTATACGATTACCGAGGTAGTTTCGCTTAGCCATGCT
TACGTTGTTTGCCGTGTGGGAAACTTGGGTTATTCTAAATTACATGTTTAAAAATCCAGTACGTTGTACCGAGGAGTTGTGAAATAAAATGTATTGTGAA
AGTGGTGATGATGCAGAGTCAAGCCTTTGTGATTTGGCCACGTATTGTCGTTAAAGACCGATTCCTTTGGAAAATCCATCCAAACACGTTACAGTGCGAC
CACACAGATATTTATGGGATGCCTATGGCTAAGTAAATTGTTATCACATGGGGGTTGGTGTGTCAATGGTTGTGGAATGCCGAGGATGAGGAGACAGAGT
TTTACACATTTATTGCCCATCATGGGTGTCTTTTTGCCTCTATTGTGGCATGGTACCAGTAGTAGGAGACATCCTCAGTATTTCCTGAGTGGATGACGGC
TGTCCTTGCCTGATACTCGGCTATGAGCCTTAGCCCAACTAGGTGGCATGCGATTTTCATTGGTTAACTTTGGAAAGGCCTTATCACGAACTTTCGTTAC
CGACGGATAAACGGTGTCAGTTTCGTGTCGTGTGGGTAAAGCGTGCAACCTCTGCAGAGATTAATGAACTATTCGAACAGCCGTGCCCACGGTCAAGGAC
GAGTTTAAGCTGTTTCTCATAGCGTATATTTGTTTGACAAAGGTTTATGGAAAAGTGATTATTGGGAAGGGTAACGTTTCCAGAGTCCGCCTGTGTGGCA
GACGGCTAACCTTTGTGGTTAGGAATGGGTTTGTGTGACCTGGGATGTCGTCTAACACCGAGGTGTTGTTAGGGCCGAGATGGTGTTGTTATGCTAGGAT
AACCAGGTGAACTATGTGAACTAGTGTTGTTGTGAAAGTGAAAAGAAACTAATAGAGGAAACAAATTAATTGTTGTTTGTTAATCTTTGACAAGTTGTTG
CAAAGCAACTTGTGGAATGGGTTGAGGTGTGAGCCTCCTCCCGACAACTAAAACTTGACTCACTAGGAGTTTTGTGAAATAAATCACTTTGCTAAAAAGG
CAGCTTTCGTAAATAAAACCCTAGCCTTCTTGTTAAACCAAACATGTCATTCTTTTTTCCTGGCTTGCTGAGTACGTTAAGTACTCACCCTTGCCCCTTA
TAATATTCTGCAGAGTATGAAGATGAAGACGTAGACCCGACCGCCGAGGAGTATCTCTAGGAGCAAGCCGAGTATGAAGACTTCTAGATGTTTCGTGCTT
AGCCCCAAGCCTTGCCTGTGGAATAAGTTAGTTGCCTAGATTCTTTGCCTAGTGCGTAGTTGCTTAGTCACTTAGTCTCTCCGCGTTGTTCGCTTCTGCG
CCGTCGCTTTTATTGTTTTTTTGTAATGTTGTGTTGCTCATCTATGGGCCTGTCCAAGATGGCAACTTATGTCAGGACTACTACCCAATGATGTAATAAA
GTAGTTACTTTAATTCCACATTTATTCTTTATGTACCAGCTAGTGTATCCTGGGACTGGTACTATCTCACAGGTAATGCATAACACCCCAGTGTGAGTTA
GTTGTATTTATGGCTAACGAATGTCGAGGCGTTATAGTCATCCACCGGGTACCCTGTGGGGGCGGGGACGGGTAATGTTTTTCACCCGACTTCTTTTGCG
GGGCCGGGGCGGGGATACCCGCAGGAGCGCGGTGGTGGGGTCATTCCAGCCCAACCCGGCTCTGCCCCGCCCCGCACCGTTGCCACCCCTAGTTCTGTCT
GCTACCACTTTCGCCCCC