Detailed information on CNT30596355


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30674019Oryza meridionalisSetaria viridis19.8627.3692.7355forward
CNT30307989Oryza meridionalisTriticum aestivum30.6928.9194.1285forward
CNT30688295Oryza meridionalisTriticum urartu21.6622.391.6760forward
CNT30368356Oryza meridionalisSorghum bicolor33.9432.4193.6294forward
CNT30370545Oryza meridionalisOryza glumipatula55.662.198.05154forward
CNT30117061Oryza meridionalisOryza nivara79.7889.1190.5221forward

Expression of CNT30596355

Peptides detected in this lncRNA

>peptide 1 (91 aa)
PWEGSSGTKAMSRRTTPGSMGRRTRSHSESDGGWSARASGVRGRTRGPTAAAVAVSAMKRRRPVEVEVESVWARGTRRRRWWPWQMRRGSGR

>peptide 2 (57 aa)
RGKGRRGRRRCRGGRRQGRWGGGRAPTRRATAAGRHARAGSGEGRGDPRQRRWRCRQ*

>peptide 3 (91 aa)
TVGRVVGDEGDVEEDDARVDGEEDALPLGERRRLVGTRERGPGKDEGTHGSGGGGVGNEAASAGGGGGGIGVGTGDEEAAVVAMADETWKRE

Sequence

>CNT30596355
ACCGTGGGAAGGGTCGTCGGGGACGAAGGCGATGTCGAGGAGGACGACGCCAGGGTCGATGGGGAGGAGGACGCGCTCCCACTCGGAGAGCGACGGCGGC
TGGTCGGCACGCGCGAGCGGGGTCCGGGGAAGGACGAGGGGACCCACGGCAGCGGCGGTGGCGGTGTCGGCAATGAAGCGGCGTCGGCCGGTGGAGGTGG
AGGTGGAATCGGTGTGGGCACGGGGGACGAGGAGGCGGCGGTGGTGGCCATGGCAGATGAGACGTGGAAGCGGGAGG