Detailed information on CNT30596295


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695480Oryza meridionalisOryza sativa84.1568.1489.74770forward
CNT30555522Oryza meridionalisOryza glaberrima6.2321.8498.2557forward
CNT30109013Oryza meridionalisOryza longistaminata31.3766.4496.86287forward
CNT30495712Oryza meridionalisDigitaria exilis6.9926.2390.6264forward
CNT30116763Oryza meridionalisOryza nivara9.5139.3797.787reverse complement
CNT30603487Oryza meridionalisOryza punctata8.225.68875forward

Expression of CNT30596295

Peptides detected in this lncRNA

>peptide 1 (41 aa)
FGTLGRPLSPLVDLPHACPAADLGRRREGEERERRKRRKSR*

>peptide 2 (34 aa)
MSLRSVFFSGICGYMDLIDDVMMFYSLDIELVFM*

>peptide 3 (53 aa)
MNLWLRPYRYSIVYYRNTMQLHALLGVKAGVHIIALHVHVLQDVMKIIDRRCL*

>peptide 4 (46 aa)
MFMVILYALSYNNLILISIEGMWFRCYTLEFILHLHHTCITFEVMS*

>peptide 5 (57 aa)
WYPGAPTFPSGRPPPCLPCCRPGKKKGRRRKGKKEAEEIEVKMEMWGFITRCPWRPR*

>peptide 6 (56 aa)
LVPWGAHFPLWSTSPMPALLQTWEEEGKEKKGKEGSGGNRGEDGNVGFYYPLPMEA*

Sequence

>CNT30596295
TTTGGTACCCTGGGGCGCCCACTTTCCCCTCTGGTCGACCTCCCCCATGCCTGCCCTGCTGCAGACCTGGGAAGAAGAAGGGAAGGAGAAGAAAGGGAAA
GAAGGAAGCGGAGGAAATCGAGGTGAAGATGGAAATGTGGGGTTTTATTACCCGCTGCCCATGGAGGCCTAGGTGATGCCACTTCGGAATGCAACTAGAG
TTCATCTCGCCATCGGTGAAGGCAAGTAAACATAGCGGTGGTTTGCTACAGCTTTGACTTGTTATTTGATTCTACCTCCACGTTGAAATTATATATCATC
AACCAAGATTATTATGTGTTACACATAGGATTTACCTATCTGAATCATACTTGTTGGTTTTACAATGTTTATGGTTATACTTTATGCTCTTAGTTATAAT
AACCTTATATTGATTTCCATCGAAGGAATGTGGTTCCGATGTTATACTCTAGAATTCATACTGCATTTGCATCACACATGCATTACATTTGAAGTTATGT
CATGAACCTATGGTTGCGACCGTACCGGTATAGCATCGTATATTATCGTAATACGATGCAGCTTCACGCCTTGTTGGGTGTGAAGGCAGGAGTACATATC
ATTGCATTGCATGTGCACGTATTGCAGGATGTTATGAAAATTATTGATCGAAGATGTCTTTGAGAAGTGTTTTCTTCTCTGGGATTTGTGGGTATATGGA
TTTGATTGATGACGTCATGATGTTTTATTCCTTGGATATTGAACTTGTCTTTATGTGAATCATAACTTGGTATTTAATTAGCTATATAATAAACCTGTGG
CTTAAATAGCTTGTTAAAGCCGTTTGGTTGCTGAGATTTTTTCTCACCCCCTTATAGTCTTTTCAGGTACTTGCTGTGACATGTTTGCATGAAGGGATGG
AATTAGCTACATTGT