Detailed information on CNT30596287


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553755Oryza meridionalisOryza glaberrima60.4623.0498.41315forward
CNT3067525Oryza meridionalisLeersia perrieri32.2520.0291.67168reverse complement
CNT30370349Oryza meridionalisOryza glumipatula60.4620.397.78315forward
CNT30101746Oryza meridionalisOryza rufipogon48.9423.9298.04255forward
CNT30576374Oryza meridionalisOryza barthii60.4616.798.41315reverse complement
CNT30116844Oryza meridionalisOryza nivara49.3319.3297.67257forward
CNT30604109Oryza meridionalisOryza punctata50.8624.1195.85265forward

Expression of CNT30596287

Peptides detected in this lncRNA

>peptide 1 (32 aa)
FLLEVTLGHKKCASFMGITKETRNDLTAREEQ*

>peptide 2 (40 aa)
MPINMTYSRCITIKQLFNLKNQEPMPCLPAFSNNLHPAHL*

Sequence

>CNT30596287
CTTTTCTATTGGAAGTTACACTAGGCCACAAAAAATGTGCATCCTTTATGGGGATCACTAAAGAAACACGTAATGACTTAACAGCAAGGGAAGAACAATA
AATCTGTCTTTTTTGCTAATTACATTTTATCTGAGGATAAACCAGTTCCTGTGCTTCTGTGTCGTGATCACGTCAAAATCGAGAGAGAGAGAGAGAGAGA
GAGAGAGTAGGAGGTTAGCATGTCATATCATACATTTAACAGATTTGACAAGCATCTATATATTTCCAAAGCTATCAATTCAGGCTAAAGATGAAGAGAC
TATTATGCCAATAAACATGACTTACAGTAGATGCATTACAATTAAGCAATTATTTAACTTGAAAAATCAGGAGCCAATGCCTTGCCTTCCTGCTTTCTCC
AACAACCTTCACCCTGCACATCTTTGATTCTTCAGAGAAGCAATCAAGCTTCTCCCATCAGAGTACTCACAGTCCTGCAGGTACTCCTCCACCTCAGCAG
CAAGGGTAGATGGTGACTGAG