Detailed information on CNT30596264


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT001126, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553947Oryza meridionalisOryza glaberrima25.1440.8681.68322forward
CNT30370210Oryza meridionalisOryza glumipatula59.9547.3297.79768forward
CNT30574690Oryza meridionalisOryza barthii62.335.2888.22798forward
CNT30117438Oryza meridionalisOryza nivara32.1647.386.17412forward

Expression of CNT30596264

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MLLCHVVGSRCVRHHGVKFKAWACHLTVLGHISSMA*

>peptide 2 (33 aa)
VFSCVSIGGECAQTDLRTSLNVSLFRIQYNHMC*

>peptide 3 (36 aa)
MCFILLKLNLNFKMWCDLWIISLLPWKAIRSYVICV*

>peptide 4 (31 aa)
MIIISHHVGKVYVLCRVKTNRLAVLAVMSGV*

Sequence

>CNT30596264
GGTGTTTAGTTGTGTGTCGATAGGGGGAGAGTGTGCCCAGACCGACCTAAGGACTTCACTCAATGTCAGTTTATTTCGTATACAGTACAACCACATGTGC
TAGTATGGGATAGCCCAAGCTTAGTAAATTATTTATGGTTTAGCCTTACATTCTGGTAGGTCGGTGTGTATGAGTTTGTATAATTCAAAGGAGCTTCCTA
TTTACCCCGAAGTGGTAGTTTAGGTGACTAAGTGTGTCCAATACAATGCTATTATGCCACGTGGTGGGTTCCCGTTGTGTCCGCCACCACGGCGTTAAGT
TTAAGGCGTGGGCCTGCCACTTAACGGTTCTAGGTCATATATCGAGTATGGCTTAGGATGGAGTAACACGTATCGTGCTGGTGTAAGTGCTGGTGTAAGG
CTAAATCATGAATCTTGGAAGGGCTTTGTTGTGAGTAATAAATCGGGTGCTCATGTATCGCGTGCCATGCTTTTTGCATGATTATTATTTCGCATCATGT
GGGTAAAGTGTACGTACTTTGCAGAGTTAAAACTAATCGATTAGCCGTGCTCGCGGTCATGAGCGGCGTGTGAATATGTCATAAGTATAGACATGTGTTT
TATTCTTCTAAAGCTGAATTTGAACTTCAAAATGTGGTGTGATTTATGGATTATATCCTTGCTGCCATGGAAGGCAATAAGGAGCTATGTTATATGTGTT
TAACATCTATTTTGATGCCCATTTGCTAAGTGTATGCTTGCTGAAATTTAATTGAAAATAAATCTGAATTTGAAATGTTCTTTGCAAACTAAATTTGCTT
TATGCTAAAATTATCCCATGTAAACTTTACTTTGAATACGCCATGCATGTAGAGTATTAGGCTTGCTTGGTGCTTGCCAGTACAATTTATGTACTGACTC
TTGCGTGTATTTGTTGTATTGTTGCATGTTTAGAATTGGTTGTAGGTGAGATCACTCTATTTCGATGGGGATGTTTCTTTCTTCCAGGATGGTTCTTACT
AGGGTCTACCCTAGTCGGTTGCAGGAAAGATCTTTTGGATAGAAGATGCTTTCGCGAACTAACTATTCGGCCAATCGGCCATACTTATCTAAGTTATAAG
TTGTATAAACCTAACTAAAACTTAGAACTTGGAATTCCCTATGTTGAGATATCATGTGCTTGAATGAAAGTATTTAGTGTGTTCCTTTTGTTAGGGACAT
ATTAAACATGAGTATGAGTTAAAGATATTTGAGATGTTGTAGATCTTTAGCCATTTTTGTCAAGTCTCCTGAATGTGTAAC