Detailed information on CNT30596240


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693833Oryza meridionalisOryza sativa94.5379.5297.41501forward
CNT30553643Oryza meridionalisOryza glaberrima95.4778.3397.04506forward
CNT3067518Oryza meridionalisLeersia perrieri34.3434.2785.71182forward
CNT30370327Oryza meridionalisOryza glumipatula95.4779.0697.43506forward
CNT30108575Oryza meridionalisOryza longistaminata86.2377.0798.69457forward
CNT30101831Oryza meridionalisOryza rufipogon95.4778.8297.04506forward
CNT30576567Oryza meridionalisOryza barthii94.5378.497.21501forward
CNT30116760Oryza meridionalisOryza nivara94.7278.9397.21502forward
CNT30604159Oryza meridionalisOryza punctata36.2336.2390.1192forward

Expression of CNT30596240

Peptides detected in this lncRNA

>peptide 1 (55 aa)
MDSNNKNLQPPPGYPTVDSEHGGRGRTTARGRKTRFIDGCIAALCCCWLCDLCCD*

Sequence

>CNT30596240
CTCAATTCAAACAACACAAATTTGACAAAGAAATTAACGCAGCTAGCTACTTGATCAAAGAAACCTCTCCTTGATCTAGTAGTGCGAGCTAGCTAGCTAG
ATTCGCAGTAGAACGCAGCCAGTGTGTAGCTAGCATGGACAGCAACAACAAGAACCTGCAACCACCACCAGGCTACCCGACGGTGGATTCAGAGCACGGC
GGCCGCGGACGAACGACGGCTCGCGGGAGAAAGACCAGATTCATCGATGGATGCATCGCCGCACTATGCTGCTGCTGGCTGTGTGACCTTTGCTGCGATT
AGAGGAAGGGCAAGAGATGATTAAAAGATGCCTTGATATTATATGTGGATAGTATTTCTACATGGGTGTGCTGAAAAGAGGATCTTTGGAGCAGAGAATT
GAATATAACGAAATGTTGTTGCAGAAAGTATACCTCCCGTAATTTCTGCGTATATTTTCGATATATAGCGCGGAATAATGAATAATGATATGCGTGAAAA
TTTTTGGACAAGCAAGTGAGTTGAGAAGAG