Detailed information on CNT30596215


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553839Oryza meridionalisOryza glaberrima40.236.9898.52203forward
CNT30370219Oryza meridionalisOryza glumipatula41.7821.9698.58211forward
CNT30101639Oryza meridionalisOryza rufipogon40.223.3698.52203forward
CNT30116861Oryza meridionalisOryza nivara40.236.9898.52203forward

Expression of CNT30596215

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MRRRRTSRGRTATTPRGEGVETEIRPTRGASSQECKE*

>peptide 2 (44 aa)
SLFDSILFLFRSSAPPPPPLVLLSGLELRREGDDMVTVRFLSKT*

>peptide 3 (65 aa)
LPVRQHPLPLPLVGATAAAAGVALRAGAPARRRRHGHSTVLVQNLIQEPDLFKRSKKFQRTQERN*

>peptide 4 (68 aa)
PCSTASSSSSARRRHRRRRWCCSPGWSSGAKATTWSQYGSCPKLNPRTGSLQEIKKIPKNTRKKLVGG*

Sequence

>CNT30596215
CTCCCTGTTCGACAGCATCCTCTTCCTCTTCCGCTCGTCGGCGCCACCGCCGCCGCCGCTGGTGTTGCTCTCCGGGCTGGAGCTCCGGCGCGAAGGCGAC
GACATGGTCACAGTACGGTTCTTGTCCAAAACTTAATCCAAGAACCGGATCTCTTCAAGAGATCAAAAAAATTCCAAAGAACACAAGAAAGAAACTAGTA
GGAGGATGAAAAAGAAATCAAGATCTAATCAATTAGAGGCTGGAGATGGTGTTCTTGGGAGGAAGGCGATGAGTTCATGAGAAGACGTAGAACCAGTAGA
GGAAGAACAGCAACGACTCCGCGAGGAGAGGGAGTGGAAACTGAAATTCGACCAACCCGAGGGGCTTCCTCGCAAGAATGCAAGGAGTAGACTCGAAAGG
AAAAGAAACTAGGAGGACCTGAATGTAATAAAAAGATGGGAACCAAAGGACTTATCTGCGGAACAGAGGGGACTCCGGGGGCTCTAATGCATAAGGGGCG
CAATT