Detailed information on CNT30596200


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 6e-125

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553681Oryza meridionalisOryza glaberrima96.9198.5292.311066forward
CNT30604086Oryza meridionalisOryza punctata74.7383.6293.43822forward

Expression of CNT30596200

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MVSEDSTSRVIVLPVKVLTKICMPPRRRRTRWRVDSFWML*

>peptide 2 (52 aa)
MSLCWSGGMPSLSWIFAFTLSIVSDDSTSSVMVLPVRVFTKICIPPLRRRTR*

>peptide 3 (52 aa)
MSLCWSGGMPSLSWIFAFTLSMVSELSTSKVIVLPVRVLTKICIPPLRRRTR*

>peptide 4 (48 aa)
MKGGLLLDVVVGEGPAILQLLASEDESLLVWGDALLVLDLRLHVVNRV*

>peptide 5 (42 aa)
MTQQMFEQQYSTFKRTRWSTTKQSRRHKQHKESFHEDNADTG*

>peptide 6 (40 aa)
MRRCWSGGIPSLSWILAFTLSMVSEDSTSRVMVLPVRVFTK

Sequence

>CNT30596200
GGAGGGAGTACTTATTAATTAGGTTAAACTGTTATGACCCAGCAAATGTTCGAACAGCAGTACAGCACATTTAAACGGACTCGATGGTCCACTACGAAAC
AAAGCAGACGGCACAAACAGCATAAAGAAAGTTTTCACGAGGATAACGCGGACACAGGATAACAGTACAGCAGCAATTCCATCAATGGTTACTGACCACC
CCTGAGGCGGAGCACCAAGTGTAGGGTAGACTCCTTCTGAATGTTGTAGTCGGCAAGGGTGCGGCCATCCTCCAGCTGCTTACCAGCGAAGATGAGTCTC
TGCTGGTCCGGGGGGATGCCCTCCTTATCCTGGATCTTCGCCTTCACGTTGTCGATGGTGTCTGAGCTCTCAACCTCCAAGGTAATAGTCTTGCCAGTGA
GAGTCTTGACGAAAATCTGCATTCCACCCCTTAGGCGCAGAACAAGATGAAGGGTGGACTCCTTCTGGATGTTGTAGTCGGCGAGGGTCCTGCCATCCTC
CAGCTGCTTGCCAGCGAAGATGAGTCTTTGCTGGTCTGGGGGGATGCCCTCCTTGTCCTGGATCTTCGCCTTCACGTTGTCAATCGTGTCTGATGACTCG
ACCTCAAGCGTGATGGTCTTGCCAGTAAGGGTCTTCACGAAGATCTGCATCCCTCCCCTGAGGCGGAGGACAAGGTGAAGGGTGGACTCCTTCTGGATGT
TGTAGTCAGCAAGGGTCCTACCATCCTCGAGCTGCTTGCCAGCAAAGATCAGACGCTGCTGGTCCGGGGGAATCCCCTCCTTGTCCTGGATCTTTGCCTT
AACGTTGTCAATGGTATCAGAAGACTCCACCTCAAGGGTGATAGTCTTGCCAGTCAAGGTCTTGACAAAGATTTGCATGCCTCCCCGAAGGCGGAGGACA
AGGTGGAGAGTGGATTCCTTCTGGATGTTGTAGTCAGCAAGCGTGCGCCCATCTTCGAGCTGCTTGCCAGCGAAGATGAGACGCTGCTGGTCCGGTGGGA
TTCCCTCCTTGTCCTGGATCTTGGCCTTTACATTGTCAATGGTATCCGAGGACTCAACCTCAAGGGTTATGGTCTTGCCAGTGAGAGTCTTCACAAAGAT