Detailed information on CNT30596192


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT007020, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30596192

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MNLDWNNTVEMVDFRVASTVPTDIKLPSTCEEHTSTTVILVWA*

>peptide 2 (55 aa)
MRVAREHVLPPTSQPLDHRSTSAPFSLSSPFSRLSVKREEKEDEKKTEEEEAKEK*

>peptide 3 (32 aa)
MTGVSQPVLSKNPGNARTPLAADNVTFRAHGD*

>peptide 4 (41 aa)
RPLPPPPDLPHQSSTSQILAPLASPRRGDSIFSVYPFSPTP*

>peptide 5 (29 aa)
MFCRRRRSLSTTGAPAPPSPSLLPSLGSL*

Sequence

>CNT30596192
CCGGCCATTGCCGCCACCGCCCGATCTCCCTCACCAGAGCTCCACTAGCCAAATCCTCGCGCCATTAGCTTCGCCTCGACGAGGTGATTCCATTTTTTCT
GTTTACCCCTTCTCCCCCACCCCATAGCAACCACCACAGCCACTTCTTTTATCGCCAGAGTTGAGCTCCTACCGTTGCCGTTCCGGCCATCTCCCTCTCC
ACCTTAGCTAGTTACCACCCTCCCCGGATGCGCGTCGCTCGGGAACATGTTTTGCCGCCGACGTCGCAGCCTCTCGACCACCGGAGCACCAGCGCCCCCT
TCTCCCTCTCTTCTCCCTTCTCTCGGCTCTCTGTGAAGCGGGAGGAAAAAGAAGACGAGAAGAAGACGGAGGAAGAAGAAGCAAAAGAAAAATAGAGTCT
GTTATATTTTGGATGGCAACCTGTGGTATTTCAAGGATTAGATAATCAGGTTGCCTATCTCGGATTTATTTCCGTTGGAGCAAGGCAAGTTATTATTCAT
CTCCTTTGAGCATAAATGCCCTATATTCCATATCTCTGATACCTCATGCATTAGTCATACATGATTTCAAATGCATAACCTGAACATAGCAAACCAGATA
TGCTAGATTTTGCTTAGCCATGCCTAGTTAGATTGCATAAAATATAATGAACTTAGATTGGAACAATACGGTAGAAATGGTTGATTTCCGGGTGGCTAGT
ACTGTTCCAACCGATATAAAACTGCCAAGTACATGTGAAGAACATACGAGTACGACCGTAATTCTCGTATGGGCATAGACCTAGCTGATTAAGTTATCTA
GCAAAGGTGGTACCTCTGTATAGTGGTTCTTCTTAAGTCCTCGTGCAAGAGGCAAACTTACGCCGAGCAGGGCGATTGTGATATTTACCGAGGCGTAGGT
AAATATCTTGATTATCTCGCGAGCTGTGTGTGTGAATTATGAAAACCTGATTGAGATGACGGGGGTCTCTCAACCAGTTCTCTCTAAAAACCCCGGGAAC
GCCAGAACTCCTCTCGCTGCTGATAACGTTACGTTCAGAGCGCATGGGGACTAGAGTTCATGGAACAGGTACCACT