Detailed information on CNT30596187


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004556, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676172Oryza meridionalisSetaria viridis18.9120.8595.1883forward
CNT30553353Oryza meridionalisOryza glaberrima93.3957.1899.02410forward
CNT30370181Oryza meridionalisOryza glumipatula33.9418.5397.32149forward
CNT30101411Oryza meridionalisOryza rufipogon79.0449.0199.42347forward
CNT30575967Oryza meridionalisOryza barthii88.6147.7999.23389forward
CNT30116552Oryza meridionalisOryza nivara94.9947.4999.52417forward

Expression of CNT30596187

Peptides detected in this lncRNA

>peptide 1 (87 aa)
MVHTLGRKIKKNNSLINSPIWFTHTTQPKSGHEHNKIHFATAPPTSNRSIRAHARARSMQQLAIKHEARMQAKPNSVCQIHGERERG*

>peptide 2 (29 aa)
NTMRSMKYPCSSCSLNYIYYIWYIHWEEK*

Sequence

>CNT30596187
CGAACACCATGAGATCAATGAAATATCCTTGCTCATCCTGCAGCCTTAATTATATATATTACATATGGTACATACACTGGGAAGAAAAATAAAAAAAAAT
AACTCCTTGATTAATTCCCCCATTTGGTTCACGCACACCACCCAACCCAAAAGCGGCCACGAACACAACAAGATACATTTTGCTACTGCTCCTCCGACCT
CCAATCGTTCGATCCGAGCCCATGCACGCGCCCGATCGATGCAACAGCTAGCGATCAAACACGAAGCGCGCATGCAAGCGAAACCCAACTCTGTGTGTCA
GATCCATGGCGAGCGAGAGCGGGGTTGATTGCTCATAGGCCGAGGGCGCCGAGCGGCGTCTTGCCCTGGCCGGCCTCGAAGTAGAAGATGAGCATGGCGA
GCATGGCGAGGCGGGCGAAGAAGAGGAAGAGGAAAAAAG