Detailed information on CNT30596152


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT007354, E-value = 4e-36

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30105362Oryza meridionalisOryza longistaminata19.3272.8189.24158forward

Expression of CNT30596152

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MGYIDGSHCGNDIINSSIYNCQLWMFTLQGRLC*

>peptide 2 (43 aa)
MPCVTGDGVLRQCICPHVFFCFLDHSNEVCLWECGCNATTDGDW

>peptide 3 (37 aa)
MDHTVGMILLIVQFTTVSCGCSHYKGDSAEISNNFSS*

>peptide 4 (67 aa)
MSAGHGSAWLFNPVISGVWGGAKSEIQVCFVLCALVCSVEIPCVLFIFFLRRCIFFVCVCVFHRVRK*

>peptide 5 (50 aa)
MIPTLYWRYTLRWVYMSRKVAPLYTHLSAHYQTILLRSIMTLKLYPDLVL*

Sequence

>CNT30596152
GCCGAATAGGGCGGTGTGATGAGTGCCGGCCACGGCAGTGCGTGGCTATTTAATCCTGTGATCAGTGGTGTATGGGGTGGTGCCAAAAGTGAAATACAAG
TGTGTTTTGTGTTGTGCGCGCTGGTGTGCAGCGTGGAAATTCCTTGTGTATTGTTCATCTTCTTCCTCCGTCGGTGCATCTTCTTTGTGTGTGTGTGTGT
GTTCCATCGAGTGAGAAAGTGAGAGCTGTGTGTGCAAGTGAGTAGCTGGGCCAACAGGTTGTGGTCCTTCAAATCGTGTATGATACCAACCCTTTATTGG
AGGTACACATTGAGATGGGTATACATGAGCAGGAAAGTAGCACCCTTATATACACATCTATCTGCACACTATCAAACTATTTTGCTTAGATCCATAATGA
CACTTAAACTATATCCTGATTTGGTCTTGTAATAATCCTTTAGATATTTATTAGTTTCTTTACATGGGTTATATAGATGGATCACACTGTGGGAATGATA
TTATTAATAGTTCAATTTACAACTGTCAGTTGTGGATGTTCACATTACAAGGGAGACTCTGCTGAAATTTCTAATAATTTTAGTAGTTAGTGATTTTAAG
TGTATTTTAGTGTGGTACTTTATCTACGTGGTTAGCTGGAGTGTTACGGGAAGAAACCATTAGACGGGGTGTAATCATATTCACATGCCGTGTGTGACGG
GCGATGGGGTGCTGAGGCAATGTATATGCCCACATGTGTTCTTCTGTTTCCTTGATCACTCAAACGAGGTGTGTCTATGGGAGTGTGGGTGTAACGCCAC
CACTGATGGGGATTGGAA