Detailed information on CNT30596145


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004248, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692950Oryza meridionalisOryza sativa49.9139.394.991138reverse complement
CNT30553534Oryza meridionalisOryza glaberrima43.2548.3695.84986reverse complement
CNT3068336Oryza meridionalisLeersia perrieri9.2138.6789.52210forward
CNT30370347Oryza meridionalisOryza glumipatula24.9177.3884.51568reverse complement
CNT30107701Oryza meridionalisOryza longistaminata10.1361.2787.88231reverse complement
CNT30101375Oryza meridionalisOryza rufipogon22.7260.896.14518reverse complement
CNT30576967Oryza meridionalisOryza barthii24.5641.687.68560reverse complement
CNT30117659Oryza meridionalisOryza nivara74.9140.4593.681708reverse complement

Expression of CNT30596145

Peptides detected in this lncRNA

>peptide 1 (65 aa)
MDPVIPFRSVARSGAPKFEVDAVRRPKSKSKTCRTLSLIFYGPKVMWWGRSILGEGLGLVPNQPL*

>peptide 2 (48 aa)
MHSLCSPYFPSSKQVPLQTNTHKTHCVAATPTLPPAIDGCYVPVSTTN*

>peptide 3 (74 aa)
MWGGVQPKENLAEALANPSRNSKLDQQKLLKSIKTESRPNQDLLQIYFYLTMSLLARRRQEIKLYTFWIRIRTS*

>peptide 4 (33 aa)
MLALFSFVQASTSANEHTQNSLCCRHSDPAPRY*

>peptide 5 (35 aa)
MSILLHFIVIPCKRLVYLILVEYYYCNIFMHCKHH*

>peptide 6 (29 aa)
MTRDVLRLPQGAHPLGLSPRHNYKAQNPN*

>peptide 7 (43 aa)
MVLRLRGSVECSFRSRIELCRDSAQIDCLSIPIGRSGPTSLIS*

>peptide 8 (45 aa)
LAASSIAPLRRLVNFSPIHRVNFEFLTHSYISLVIDIVRLIYRLS*

>peptide 9 (39 aa)
MRCVACFADSQQLGRNFDVGPKRYESRLHKLSNKYSWTP*

>peptide 10 (41 aa)
MSPLVTNRAETWLISPRRLIPACESKNTSKNKIDCNTISYE*

Sequence

>CNT30596145
CTGGCGGCCTCCTCTATTGCTCCACTCCGTAGACTTGTGAATTTTAGCCCAATTCATCGTGTCAATTTTGAGTTCTTGACCCATTCATACATAAGTCTGG
TTATCGACATCGTCCGATTGATTTATCGTTTGAGTTGATGTCGATTCTCCTCCACTTTATTGTCATTCCCTGCAAAAGGTTAGTATACCTAATACTAGTG
GAATATTATTATTGTAACATATTTATGCATTGCAAGCATCACTAGTTCTCCTCTATTTTGGTAATATTGACGGTCAAAACTGATTGATAATGACCATCAA
CACCGTCATCGTTTAGAGTCAGGTTTTGCTTAGATTATTCTGTCAAGAATAGTTTCGCCGCTAGATCGGTTTATAGAACCCCAAATTTGAGTGCTTAATC
ATTCATATGCAATTGTGTTGCAATCTAAATTGTTTTTGCTTGTGTTCTTCGATTCGCATGTAGGGATTAGCCTTCTCGGGGAGGTCAACCAGGTTTCAGC
ACGGTTGATAACTAGAGGAAACATGGTGCTGCGATTGCGGGGCTCAGTAGAGTGTTCATTCAGAAGCCGGATCGAGTTGTGTCGCGACTCCGCCCAAATC
GACTGTTTATCAATACCTATCGGAAGATCGGGACCTACATCCCTCATCAGTTAAAAATATCTCAAATCTACAACCACCAAAATACCTAACAATCTGATAA
TTGAGGAAGCGGCACGGAAGAATTTGCCGTGAGGTGGAGGTGGCAGTCAGCCTTGAGGTGGAGGCGGCAATCGCATGTGGGGAGGGGTTCAGCCAAAGGA
AAATTTGGCAGAAGCACTGGCAAACCCTAGCCGCAACTCCAAACTCGACCAACAAAAACTTCTGAAAAGTATAAAAACGGAATCAAGACCAAACCAAGAC
CTTCTCCAAATCTACTTCTACCTCACCATGTCACTTTTGGCCCGTAGAAGACAAGAGATCAAGTTATACACGTTTTGGATTCGGATTCGGACCTCCTGAC
AGCATCAACTTCAAACGGACATAGCCGCTGATCTAGAAGGAATTTCGGGACCCATGAATACTTGATGGAAAGCTTATGGAGTCTACTTTCAGATGGGTAT
TGATAAATAGTCGATTTGGGCGGAGTCGCGACACAACTCGATCCAGCTTCTGAACAAACATGCTACTGAGCCTCGTAATCGCAGCACCATGTCTCCTCTA
GTTACCAACCGTGCCGAAACCTGGTTGATCTCCCCGAGAAGGCTAATCCCTGCATGCGAATCGAAGAATACAAGCAAGAACAAGATAGATTGCAACACAA
TTTCATATGAATGATTAAGCACTCGAATTTGGGGTTCTACAAACCGATCTAGCGACGAAACTGTTCTTGACAGAATAATCTAAGCAAAACCCGACTCTAA
ACAATGGCGTCTACTGATTAAGTATGACTAGGGACGTCCTAAGGTTGCCACAGGGTGCACACCCCCTTGGGCTAAGCCCACGACACAATTACAAGGCCCA
AAACCCAAATTAGATTCGGACTAGATGAGGTGCGTGGCTTGTTTTGCAGATTCCCAGCAGCTCGGTAGGAATTTTGACGTGGGACCAAAACGATATGAAA
GTAGACTTCATAAGCTTTCCAACAAGTACTCATGGACCCCGTAATTCCTTTTAGATCAGTGGCTAGGTCAGGAGCCCCGAAGTTTGAAGTTGATGCTGTC
AGGAGGCCTAAATCCAAATCCAAAACATGTAGAACTTTATCTCTTATCTTCTATGGACCAAAAGTGATGTGGTGGGGTAGAAGTATACTTGGAGAAGGTC
TTGGTTTGGTCCCCAATCAACCTCTTTGATCATCTATGCATTCGTTATGCTCGCCCTATTTTCCTTCGTCCAAGCAAGTACCTCTGCAAACGAACACACA
CAAAACTCATTGTGTTGCCGCCACTCCGACCCTGCCCCCCGCTATTGACGGTTGTTATGTACCAGTTTCGACCACTAACTAGCACAATTAATAAAAGGAA
AATTAGCATTTCTTACACGCATACCAATAATAAATAATGTAGTTGTATTAGGATTGGAGAACTAATGTTGATGCAAGAATTATACACCAAAGTGAAGGAG
AAATGAAATAGACATGCAATTTAATAATTAACTAGAGTTGGATTGTGATGATTACATCCATTTCAAATTACTTGTCGTTTCAGATTTGTCCAAAGTCAGT
TAAATATTTTTATTCTTTATAACCATTTTCTATAAATTCGTATAGTTTAGTAACATGTGAATGATATATACCTAAGTATA