Detailed information on CNT30596095


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30523988Oryza meridionalisSetaria italica24.7220.0695.4566forward
CNT30441862Oryza meridionalisAegilops tauschii30.719.3590.2482forward
CNT30243815Oryza meridionalisAvena sativa29.9626.8596.2580forward
CNT30463851Oryza meridionalisSaccharum spontaneum32.9614.8493.1888forward
CNT30346729Oryza meridionalisEragrostis tef20.9716.9787.556reverse complement
CNT30108589Oryza meridionalisOryza longistaminata29.2114.1697.4478forward
CNT30101300Oryza meridionalisOryza rufipogon51.6919.11100138forward
CNT30116476Oryza meridionalisOryza nivara50.1920.9100134forward

Expression of CNT30596095

Peptides detected in this lncRNA

>peptide 1 (87 aa)
RLVGVGGGGVLGLVAVVDDGVEAVGRCVGGEPLLDGEELLRAAESVPPFQIVPVRTYIVYTHLFSGSDDASATVIPSAAAAASSSVAA

>peptide 2 (36 aa)
SARRRRRRRRPWPCCSCRRRRRGGRAMRRWRATARR*

Sequence

>CNT30596095
CTCGGCTCGTCGGCGTCGGCGGCGGCGGCGTCCTTGGCCTTGTTGCAGTTGTCGACGACGGCGTAGAGGCGGTAGGGCGATGCGTCGGTGGCGAGCCACT
GCTCGACGGTGAAGAGCTGCTGCGCGCAGCCGAGTCCGTCCCGCCCTTCCAGATCGTCCCCGTCCGCACGTATATCGTGTACACGCACTTGTTCTCCGGG
TCCGACGACGCCTCCGCCACCGTGATCCCCTCAGCCGCCGCCGCCGCGTCGTCGTCCGTGGCCGCCA