Detailed information on CNT30596084


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30226404Oryza meridionalisHordeum vulgare4.2928.2591.52224reverse complement
CNT30104545Oryza meridionalisOryza rufipogon42.8396.1399.62236forward

Expression of CNT30596084

Peptides detected in this lncRNA

>peptide 1 (61 aa)
MIRTSNACFEKRALLGWFDRGSRPELSFVLLFNRQGNKTRIEMSIKSRNKHIMIIGREGYA*

>peptide 2 (46 aa)
MVCASIVQVPFSFVDGVELHNSPXVLMHYHPRRWFVLVLCKCLSLL*

>peptide 3 (66 aa)
MFPFRYWHPESSLLILRSRGAKEARALGVRISLVRGRVLYRWCSSYTSLYPYWKSNNHLAHPDSRE*

>peptide 4 (64 aa)
MQVLGRYYTENRPDGFELDCLPESMRHSTQLKNSLPPGFFARHRALWRLSVKSVHRPWSFPISF*

>peptide 5 (81 aa)
MERYRSTMNLSNFFDHCLGAHTSSSSTTICDLLFPEFRTPRVAPCRSPPPRCCRGERPYSRLVEIDASPRPLLYRESSGWF*

>peptide 6 (72 aa)
MVAGWFDRAEKEILGHPHELILLLFGSPSGQLTKDYRDEFHSNCGLRRMASWLLKLEIPCSRNERVNHPGTR*

>peptide 7 (30 aa)
MFRRKRNPEEALTRLISLTSEGIPLYSNRY*

>peptide 8 (31 aa)
MQRNKRVWDSHVKAFIDNYYFFVSCVASKNG*

>peptide 9 (31 aa)
MDTICILTVEYREFHPRNIPSNNIVYCSILI*

>peptide 10 (35 aa)
MRVRKKGSPIRKVDPIPITYRERVQYPPTKKQLKS*

>peptide 11 (35 aa)
MHNIKVKSNLPRGKPESFRFATIVVTHWVGQLVMV*

>peptide 12 (32 aa)
MIDRFHRQAKQIXLENRRADLHSRVVLSNFRI*

>peptide 13 (32 aa)
MVCASIVQVPFSFVDGVELHNSPISSFPRSRS*

>peptide 14 (37 aa)
MELEEKIGLNPTSKRGRLHPHLLWGSLLTRASGFGES*

>peptide 15 (42 aa)
MIDRFHRQAKQIGERREVAPAGQDKYLSVGHRSLGRQRLSIG*

>peptide 16 (35 aa)
FLGHRESNTLYFISFPYMTLAIWLGFLLRAYALSS*

>peptide 17 (36 aa)
MLTRRVRLAKDLLRQLQEQREAHLPPQQGWKGIDRP*

Sequence

>CNT30596084
CTTTCTTGGGCATAGAGAAAGCAATACATTATATTTTATTTCTTTTCCATACATGACTTTAGCCATTTGGCTTGGTTTTCTGCTTCGTGCTTATGCATTA
TCATCCTAGAAGATGGTTTGTGCTAGTATTGTGCAAGTGCCTTTCTCTTTTGTAGATGGAGTGGAACTACACAACTCTCCTNNNGTGCTTATGCATTATC
ATCCTAGAAGATGGTTTGTGCTAGTATTGTGCAAGTGCCTTTCTCTTTTGTAGATGGAGTGGAACTACACAACTCTCCTATATCCTCTTTTCCGCGATCA
AGAAGTTGACGGTATGTAGGCTCATCTACCCAATGATTGTTAACCGTCTACTCCAGTAGTTGTTCGGTTCTTAGTCGATAAGTCTGTCTTCTGTCTATTC
TTCTTCGAACTTTCTGTCAAATCAAGCAATTCCAATTTAAAATTCCAAATCCCACCCCCAAGCGGCGATGATCCGTACATCGAACGCCTGTTTTGAGAAG
AGGGCATTGCTAGGATGGTTTGATCGAGGGTCACGACCTGAACTATCTTTCGTTTTGTTATTCAATAGGCAAGGGAATAAAACTAGAATTGAAATGTCAA
TAAAATCCCGAAATAAGCATATCATGATCATAGGACGGGAAGGTTATGCATAATATCAAAGTAAAGTCAAATTTACCAAGAGGTAAGCCGGAATCCTTTA
GGTTCGCTACGATAGTTGTTACTCACTGGGTGGGTCAACTAGTCATGGTATAGTTGTTTACATGGTAGCAGGTTGGTTCGACAGAGCAGAGAAAGAGATT
CTGGGTCATCCCCATGAGCTGATACTGCTATTGTTTGGATCGCCTTCAGGGCAGCTAACTAAGGATTATCGGGATGAATTCCATTCCAATTGTGGGTTGA
GAAGGATGGCAAGCTGGTTACTCAAATTGGAGATACCCTGCTCTAGGAATGAAAGGGTGAATCACCCCGGAACGAGGTAAAGGGCTAGATTGAGAAAAGT
AGTATACTTAGTTAGGGTCGGTTTGAGTAAAATAAGTGAGTGGGACTCGCGAACTGGACAGTAAAGTGACAATAGGGTGGTCACTCGTAATACTATTGTT
AGGGAAAGCCTAGTAAAGTGGTCAACTAATAAATATTGTCAATAAAGAAAGGACTGGATCAGAGAAGTATGATGTAGTCCCCTTCCCTGGGTATCACGAA
CGGGGCATCACAACCATCATTCGAGGAATGTTTCCATTCCGATACTGGCATCCGGAGTCCTCCCTACTGATCCTTCGGAGCCGGGGTGCAAAGGAAGCAA
GAGCACTGGGAGTACGAATATCCTTAGTCCGAGGAAGGGTGCTATATCGGTGGTGCAGTTCTTACACATCATTATATCCATATTGGAAATCAAATAATCA
CCTGGCCCACCCCGATTCTCGAGAATAGAAGAGCTGACTTGCATTCGAGGGTAGTGTTAAGCAACTTCCGGATATGATCGATAGGTTTCACCGTCAAGCA
AAGCAAATAGNTCTCGAGAATAGAAGAGCTGACTTGCATTCGAGGGTAGTGTTAAGCAACTTCCGGATATGATCGATAGGTTTCACCGTCAAGCAAAGCA
AATAGGAGAAAGAAGAGAAGTAGCACCCGCTGGGCAGGATAAGTATCTATCAGTTGGCCATCGGAGCCTAGGCCGGCAGAGACTATCCATAGGTTAAGTT
GGTTCTGGTTGGAGGATTAACCCTCTGATTGTGATGCTTGGCTTTTGGGCCTCGGAAAGGAATCAAACTAGGCAAGCAAGGAGGGGATAAAGGACCACGG
AACGAGGTAAAGGGCAACCCCTTGACCGAGTGAAGGCGAGCCCGGATTCAAAGTAAGATGGATTGAAAAGACTCCTAAAACTGCCCCCGCTGGGGTAGAT
AAAAAACCTTTGTCCATGGCCTTACCTTGTAGGAAAGGATCGCTCGCTACTGGTAACCGTTAATTCGTAAAACGTATGTTTCGTAGGAAGCGGAATCCCG
AGGAAGCTTTGACTCGGCTTATTTCATTGACAAGTGAGGGCATACCTCTCTACTCAAATAGATACTAACTAGAGTCTATAATATCTAGTAACTATCGTCT
ATTTCCTATTGGCTTAGCACTTAAAGTAGGGAAATCTCTCAGGGTTATCCCATGGATACTATTTGTATTTTGACTGTTGAGTACAGGGAATTCCATCCTA
GAAACATACCATCTAACAATATAGTTTACTGTTCCATTCTGATATGAGAGTGAGAAAGAAGGGTTCCCCGATAAGGAAGGTTGACCCGATACCCATAACC
TACAGAGAGCGAGTTCAGTATCCGCCTACAAAGAAGCAACTAAAATCCTGACTGACAAGGTTTGAGGGTATCTAATAGCAAAAATCTCCTTCTAACAAGA
CAGGGTATTCACTACTGTAAGGTACTGAGAGAACAGGTACTTAGATCACAGACTTTGACACTTCTTCCTCCGCCTACCTCCTTGTGAGCAGCCGCTTTTT
CTTCTTTCCGTGGAGAAACCTAGTAACTTGGTTTTATTTTCCAACTCCTACTTTATTTGCCGCCTATTCGCTGGCACCAGTGACTTAACCAGTTAAAGCT
TCTTTTTTTCATTTCCAGGATCGGCCTACTGAGGACGTAGCGAGATTAGGACTTTTGCCGGTATATGATCCTACTTTTTTTCTTAGAAAGCTAGGACCTT
TTTAACATAAAAAAGTAAAGGTTAGAGGGTAGCCTACCTACATGGAATTGGAAGAGAAAATAGGTTTGAACCCCACTTCAAAAAGGGGCCGTCTACACCC
CCACCTCCTTTGGGGATCCCTACTTACCCGAGCTTCCGGCTTTGGCGAATCGTGAATACATGTTAACCAGAAGAGTCCGACTTGCTAAAGACCTCCTAAG
GCAGCTGCAAGAACAGAGGGAGGCTCATCTGCCCCCACAACAGGGATGGAAAGGTATCGATCGACCATGAACTTGTCGAATTTCTTTGACCACTGCCTCG
GAGCCCATACAAGCTCTTCTTCAACAACCATATGTGACCTTCTTTTCCCCGAGTTTCGAACCCCTCGGGTTGCACCATGTAGATCTCCTCCTCCTCGTTG
TTGCCGTGGAGAAAGACCGTATTCACGTCTAGTTGAAATAGATGCAAGTCCTCGGCCGCTACTATACCGAGAATCGTCCGGATGGTTTTGAGCTTGACTG
CTTACCTGAAAGCATGCGGCACTCAACTCAGCTGAAGAATTCACTTCCACCCGGGTTCTTCGCGAGACATAGGGCACTTTGGCGGCTATCGGTGAAGAGT
GTGCACCGTCCTTGGTCCTTCCCCATTTCCTTTTGATCGTATTACGCTTGACTCGCTGCAAAACATTTCGCTTTCTGCGCTCGCTCGTACGTGGTTTACA
CTCCTTGCCTTTCATCTGACTTTGCCATCGGGCAATTGTTTGTTTTCAACTGGATTGGATTCCGAACCAAGAAAGATAGGCAACTTTCACTTGAAAGAAA
GGAGCTTCAGAACTATTGTATTCCACCGAATAAGAATAAGAGCAAGAAGGGGCTATCTTTGTGAAGGGACCGGCACCAGAAAGTAGATCATATGGCCTTT
CTTTCGCCAAAAAAAATAAAGTAAAGCCCCGGCCCAAGAAATGCAGCAAAGCAAGTCGTCTTTGGTTTGGAAGAGAGGATGTGCTTTCCGCATTGAAGTT
AAGGATTGAATGAATTAATTGTCCGAAACCCTACTTGTGAATGAATGTCTCCTGTCCTTTGGCATCCCAGTGAAGAAGTTGACTTACTTCCGAATGAAGC
GAACTCTGAATAAGGTTTTCAGATCGACCAAAAAATATATTATTTATTGTAAGTGAACGGAGAAAAAATCCAAAGTCTTTTAAATAGGACGGACAGGCTG
CTCCCTCTTGAGGTTGCAGGATCTGTAGTGACATCTTCTCCTGATGTGCAATTGGAGGCACTTGTGCTAGTTGCTGCATCTTCACCGATATCATTTATAT
TTCCATCTTCCTGCACTTGGTTGACAAACCCTGAAACCATAACACAGATTTCAATCTGCTCTTGGAAATCCTCGAAACCCATTCCATATCCAATCTTTGG
ACTACCACCCATATCTCCTACTATCGACCCACCACTGGATAAGCGAAGAAGTACTGCGAGGAGTTTTCAATTCACTAGCCGAACAAAGATCCTTCAATGC
AAAGGAACAAAAGGGTATGGGATTCTCATGTCAAAGCATTCATTGATAACTACTACTTCTTTGTTTCATGTGTTGCATCCAAAAATGGTTAATTAAGTAA
TAGCATTTATATTACCAATTTGCTTTCAACTCTTATTGAAAAAAGCTCCGACCTTGGCTGTTTAGCAGTACATCCATAACTCCGAGCTTGAAAGTTTAGC
AGTACACCCATAAGTGAATCCGGAAGTAACGTAGTACAGGGCGTAGCTCAATCTTCTCTCGCTGGATCCCAACCTAAAAGTAGCTAAGAGTTTTCCGGGC
CTAATCTAAAAGATAGCATAGAGTTGTCAGTTTAAGTAGCTCCCCTTTTCCCGAGTGCGGGAGTCAGAGCATCCATTTCATTCGTTTAGGTGGGGAAGAG
GAAAAGCTAGACAAGCTTGCAATCGATCAGCTGCAAGTTCTTCGAACTTATAATAGCGGGAATCTGGTCATTGATCCAAAGCTCACAAAGAGATAACAAA
CCAAACAATTCATAGGAGTCCCCCACTAGTGCCGGTTTGACATCCACTCCAGCAGCGCACCAAGAGAATCAAGTCAGTGGTAGTTATATAAGTCATCTCC
GACGAAACAATCATCCACTACTTCAATACTGGCTTTTCGCCCCAGGCCTCCCTCTTTGGGAGCAGTTCGTGTCGTAAGATGTCAGGTTGAGTCCGCCAAC
GAACGCAATCCCTAGAATCTGTTTTGATCTTATTATTTGCTTTCAATAAGAAGCGGGAGATAAGCCTTCATGACTGCAATTTCCAGCCGGGAAAGAAGAT
CAAGGCCACTGCTTTTGAGCCGGTACCCACCAAAAATCATATAGAGTGTAGTTTGTCAACTCAAACTTTCCTGGCTTCATTTCCCATTGTCATTTCTTTT
TCCAAAAACTCATTTGCTAAGTAGAATAGTTAAAATTCATGCTCTGCTAGAGCAAACACACTTCTCGGGATTGATGTCGTCTCCGTCTACTTTTTCTCTT
AACTCACTCAGAGAGAGAGGC