Detailed information on CNT30596072


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30100058Oryza meridionalisOryza rufipogon21.0963.4100298forward
CNT30574730Oryza meridionalisOryza barthii21.0958.297.99298forward

Expression of CNT30596072

Peptides detected in this lncRNA

>peptide 1 (86 aa)
MHSNHQPISDSGQSILSASCGSVSFASELKSIFSKKGLVNAHPRRSAPPSLPIVPKVCMSLVSLRPGISQLFLPLHPNLNTPVTRL*

>peptide 2 (39 aa)
MHALQYAKIAKENPSINSGIQPRNEKVYIGNALQPPTNK*

>peptide 3 (38 aa)
MEAPVDIERKTIDRYYCCSSLFLSSMKVQPPIFHTFSY*

>peptide 4 (34 aa)
MHSNHQPISDSGQSIXXXXXRLTVEFNQEMKRYI*

Sequence

>CNT30596072
TACTAGCTAGGAAATTCCCTAACCTCGATATGAACAACTTACTCAACTCAACAGAGTAGCAAATGCCCAAGAAAGCCCGAGTCAATCTATTTGGAAATCC
AATCTATTTTCTCGTATTCGTGTGGGAAATCAAGCTATTCTAGTTGAAATTCACCAGAAGAAATGCACGCACTTCAATATGCCAAAATTGCAAAGGAAAA
TCCTTCGATTAACAGTGGAATTCAACCAAGAAATGAAAAGGTATATATAGGAAATGCACTCCAACCACCAACCAATAAGTGATTCCGGGCAATCAATTNN
NNNNNNNNNNNTTCGATTAACAGTGGAATTCAACCAAGAAATGAAAAGGTATATATAGGAAATGCACTCCAACCACCAACCAATAAGTGATTCCGGGCAA
TCAATTCTATCCGCGAGTTGTGGAAGTGTTTCATTTGCCTCCGAACTGAAGTCAATCTTTTCCAAAAAAGGTTTAGTAAATGCACATCCTCGCCGCTCGG
CTCCTCCCTCATTGCCCATAGTCCCTAAAGTCTGTATGTCTCTTGTCTCTTTGAGACCGGGGATTTCCCAACTGTTCCTTCCCTTACACCCTAATCTTAA
TACCCCTGTTACCCGCCTGTAGGCGGATCCTACCAACCAAAATAAAGTGACCGAAAGACACAATTGCATCGGTCCAATGAGACATGGAAGCACCAGTAGA
TATTGAAAGAAAAACTATTGATCGGTATTATTGTTGTAGTTCTTTGTTCCTTTCGTCGATGAAAGTACAACCACCCATTTTCCACACTTTTTCATATTGA
CTTAAGTCAGCGAATTACCCGCGGCGAGGAGGAGAGATTAGAACTCCTGGATTGAAAAACTTTTTCTTCTCCTTGCTAATTGCCTACTCAACACTTGAAC
ATTGGTGTGTTTCACATTCAACTCTATCTAGCCAAATATCATAGCTAGCCCAATGCATTTCCTCGTCGTAGTGAAGTGAGGGAAGGAATTTACTAGCTTA
ACTAACAATACCAGGCTTGTCCGCCGTACTTCCTATATATAGTATTGAATTTACTAGAGCATATTTTACTAAGTGGTGTGTGTAGTTTTTACATTTCCTA
CGCTTTTCGTATCAATTCCTCCCTCTTTCCTCTTTCAACACTTTGGCCCTTTTATCATATAATTGAATTGAATTGTCTTGGCATTTAGCATTTGCTCTCT
TCTGGGACCTAAAGAAAGTGAGTGCCTGTAGCGATGAGTGCCAGCTTTTTCATAGATTGACTTGGGTGTTGCATCTCTTTTTCCAACTCGGATTTACCAT
TGGCTTGTCGTCCTCTCTTACCTGACCCTGTCCTATAGAAAGTAGTGTGTAGTGTGCTTAAAAAAAAGCAAGTTTAAATATAACCCGCAAAAATGAAAGC
TCGCTTTGATTGA