Detailed information on CNT30596070


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369310Oryza meridionalisOryza glumipatula97.4599.7598.51804forward
CNT30110426Oryza meridionalisOryza longistaminata23.2718.2985.42192forward
CNT30574922Oryza meridionalisOryza barthii100.1271.798.67826forward

Expression of CNT30596070

Peptides detected in this lncRNA

>peptide 1 (42 aa)
LPPRNPSRHHSRDGASPPPPRAASPRHTDALRSCAAAPSSST*

>peptide 2 (81 aa)
FLPETLAATTPVTVRRLPLLAPPLPATPTPCAVAPPLHPPAPNLAPTPPHASPHVLHFLSLLAVDAAELELKVGRSGFQSG*

>peptide 3 (32 aa)
MEFSKSWSIVLLDGWTGISVAFCSVAEKVEAM*

Sequence

>CNT30596070
CCTTCCTCCCCGAAACCCTAGCCGCCACCACTCCCGTGACGGTGCGTCGCCTCCCCCTCCTCGCGCCGCCTCTCCCCGCCACACCGACGCCCTGCGCAGT
TGCGCCGCCGCTCCATCCTCCAGCACCTAACCTCGCCCCGACACCGCCACATGCTTCGCCGCATGTCCTCCACTTCCTCTCTCTTCTTGCTGTCGATGCC
GCTGAGCTCGAGCTAAAAGTAGGTCGATCTGGCTTTCAATCGGGTTAGGTCTCCGTCCTTAGCACCACCTCGTCGGCGATTTACCTTCGCCACAATCCAA
GCCCCACGCTGCCTTCAGATCTGGTGGCATCTACCTTGCAGCGGCCAGATCTGGCGAAGAGAGGAGGAGCGCATGGCGGAGCGGGCCTGAAGTGTGTTGC
TGACGACGTCCCCGGTGTGGTGGTGGTTCACTGGTTCAGGTGGACAATGCCTCGAGCTTGCTAGAAATGGCGTTGGCATGGAGTTCTCCAAGTCCTGGAG
CATTGTTCTGCTTGACGGGTGGACAGGGATAAGTGTGGCCTTTTGTTCTGTAGCTGAAAAAGTGGAAGCTATGTAAGGAATGTTAGCTAGCATATGATCA
GAGTGATCTAAGGTTTCAGTCTGTTGGATAGGATTGTGTTGGCTTAATGTTTAAGCTTTTGGGTATAGGTGGAGATCTCTTAGTAGCTTTCTTTTAAGCT
GGTAACCCCCAAGCCTTTTGTCTTCTGAAAACATCTCTATGAAAATATTTACAGTTTGTAGTTCAGTAAAGCAATTGATCAACATGAGTATTATATTTTG
ATATGCGAATGTTGTTCTCACAAAA