Detailed information on CNT30596015


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30105423Oryza meridionalisOryza longistaminata40.2430.0988.62167forward

Expression of CNT30596015

Peptides detected in this lncRNA

>peptide 1 (35 aa)
LGEHRVLVLGADGLLQILELGLGVVVVVIVVERGR*

>peptide 2 (98 aa)
LVSTVSSSSAPTASSRSLSWAWASSSWSLSSSVVDDDGQSEAAGHGDGDRRRELQLLDMVMGRRRREGHCCGGGGSHYSPPLTAREEEQCSSLAVSLR*

Sequence

>CNT30596015
CTTGGTGAGCACCGTGTCCTCGTCCTCGGCGCCGACGGCCTCCTCCAGATCCTTGAGCTGGGCCTGGGCGTCGTCGTCGTGGTCATTGTCGTCGAGCGTG
GTAGATGATGACGGCCAGTCGGAGGCGGCGGGGCACGGAGACGGAGACAGACGGAGGGAGCTGCAGCTGCTTGACATGGTGATGGGAAGGAGGCGGCGCG
AGGGCCATTGCTGCGGTGGTGGCGGGAGCCATTATTCCCCACCACTAACAGCTAGAGAAGAAGAACAATGCTCTTCTCTCGCAGTCTCGCTTCGCTAGCT
AGCTACTCCACAAAACAAGAGAAGAGAGAAGCTTGAGGTGGCTGGCTGGCTGGATCTGGAACGAATTCTGGTCTGGATGGATGCATAAAACGAACGATGA
ATTATCCCCCCCCCC