Detailed information on CNT30595996


BLAST search results

BLAST vs Swiss-Prot:
sp|P49214|RS9_TOBAC, E-value = 9e-22

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555382Oryza meridionalisOryza glaberrima62.4528.1196.24346forward
CNT30250094Oryza meridionalisAvena sativa25.9916.991.67144forward
CNT30445986Oryza meridionalisSaccharum spontaneum29.0635.6281.99161forward
CNT3068318Oryza meridionalisLeersia perrieri41.3469.3982.97229forward
CNT30342367Oryza meridionalisEragrostis tef19.8635.8390110forward
CNT30369943Oryza meridionalisOryza glumipatula44.95100.8198.8249forward
CNT30100645Oryza meridionalisOryza rufipogon81.2366.8696.89450forward
CNT30117069Oryza meridionalisOryza nivara50.7250.3697.51281forward

Expression of CNT30595996

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MIITETTSCKLLFSFLIFLLTVTATATCLLLVLPLHPTRGASTEWACQ*

Sequence

>CNT30595996
GGATTTGGATCTTTTGGTCTGAACATGTAAATATTACCTGATACGCTACTAAATTAATCTTTAACAACTCCATAATCCATGTTGCAACTTCCAATCCATA
AAAACACTAAAACCACCATTGGTACGAGTGAGTATCACTAGTTCAAGCACACTGGTACGAGTGAGGATACCATGAAACGAATCCATAAAACAGCATTAAC
CACAAGTCTATACCTAACATAATGCCAAAAAGTGCTAACATAAACCAACATCTGAAGGACAACCTGCTTGAATTCTGAATCCCAGATAGGCAAGCTACAG
AATTTGGGCCCAGTTACTCAGCACAGAAAGTTTTATGATCATTACGGAAACAACTAGTTGCAAACTTCTTTTCTCATTCCTCATCTTCCTCCTCACCGTC
ACCGCCACCGCCACTTGCCTTCTTCTGGTTCTTCCTCTTCACCCTACCAGGGGGGCCTCCACCGAATGGGCTTGTCAGTGAGAAGTCAATGTGCTTCTCA
GACTCAACCCTCACCATGAACGACGGGATGTTGACAATTTGCCTGCCGACCCTG