Detailed information on CNT30595987


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003442, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692489Oryza meridionalisOryza sativa73.85100.1197.11901forward
CNT30553012Oryza meridionalisOryza glaberrima7094.1695.67854forward
CNT30369760Oryza meridionalisOryza glumipatula64.191.0496.8782forward
CNT30105059Oryza meridionalisOryza longistaminata76.3110097.21931forward
CNT30101055Oryza meridionalisOryza rufipogon79.0210097.1964forward
CNT30575926Oryza meridionalisOryza barthii69.1100.697.03843forward
CNT30116356Oryza meridionalisOryza nivara56.3164.3996.07687forward
CNT30603889Oryza meridionalisOryza punctata78.1185.3994.65953forward
CNT30550796Oryza meridionalisOryza brachyantha54.1852.0584.57661forward

Expression of CNT30595987

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MVDPIFNGESWTTELGYLPELSTTICIVE*

>peptide 2 (34 aa)
MPFLCYLLHPKLMIHFMFSLFSDAYYDVQCGCLN*

>peptide 3 (47 aa)
QTMSNTSIRPAVCPHLQKGLETLRFHAIKRNSVTPPCRFFATYCIPS*

>peptide 4 (50 aa)
MKTITIKRIEDFILFFLRICRENYSGSGTGSSSHLKLNTTLYQEQMNNEW*

>peptide 5 (37 aa)
MMVLIIQFLLLILKVLCQDKKSLCRPPSHENNYHQEN*

>peptide 6 (39 aa)
MNGRSNLQWRIMDHRIGLSSRAIYDYMHSRIDAIMQVCN*

Sequence

>CNT30595987
CAAACCATGAGTAACACTAGTATAAGACCAGCCGTTTGTCCTCATTTGCAGAAAGGGTTAGAAACCCTTAGATTTCATGCCATCAAGCGTAACAGTGTAA
CCCCACCATGCCGTTTCTTTGCTACTTATTGCATCCCAAGTTGATGATCCATTTCATGTTCTCTCTTTTTTCAGATGCATACTATGATGTCCAATGTGGC
TGTCTGAACTGAAATCTGAACTCTGAACTCTGAAGGCTGTTGTTTCCATCAGGTGCATTGGTTCAGCAGCGATCGGTGATCTATGTTTTCATATTTGGTC
ACGTTCTACCGGGCTTTTTCGATGGAAATGAAGGTAATTGGAGGAGTTCTATCTGTTTGATGGAATTCAGAACCAAAATCCGAATTCCACAAAATGGCTA
GAGGCAAATTTTTAGGGCTATTTGCAATTCCACAACCACAAGCATGGCCAACTGGTAGTTCTCCAAGTAAAAGAAGTTAGGAGCTGGTTATGATGGTACT
AATTATTCAGTTTCTTCTATTGATCCTGAAAGTTCTATGCCAGGATAAGAAAAGCTTGTGCAGACCTCCAAGCCATGAAAACAATTACCATCAAGAGAAT
TGAAGATTTTATTCTTTTTTTCCTTAGGATCTGCAGGGAAAATTATTCAGGTAGTGGAACAGGTTCAAGTAGCCATTTGAAACTCAACACGACTTTATAT
CAAGAACAAATGAACAATGAATGGTAGATCCAATCTTCAATGGAGAATCATGGACCACCGAATTGGGCTATCTTCCCGAGCTATCTACGACTATATGCAT
AGTAGAATAGATGCAATCATGCAAGTGTGCAACTAGTAGTTTTTTTTCTGAAGGAGATGAGATTAGGTGTAGCATGTAATGGTCCTGGTGTATAATGCCA
TGGCACACTCAACTTGCATTTAAACAATGCTAGTCCTGCAGACCTTGCCAAGTTCTCTGCTCATCCTCATTAGGTAATTTGCCTTTGCTTGCTGCGTGTG
CGCACCTAAACTTTTATATTTGCTTGAGAATCCTGCAACCCCAACTTAATTTGGAATTTAGTTGAGCAAAGTCGCTGTCATGGCCTCATCTAGGTAAGAA
AGATAAGAGCAATTTGCACAAATTGCCGACTAAAATATCACTCATCAAATCGCAAAACCACGGTTTCATAAGGCGCCCACCGTTTCGCGCGTCGGTTTTC
ACATCCCTGTAGAAGTGGTA