Detailed information on CNT30595978


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Expression of CNT30595978

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MDPLHWEKKCCSVFSSVLGGVVPRHCHHMVALILRLFTGIEKDKRR*

>peptide 2 (56 aa)
MEAAFHGDFIDHCSDPGPNDVGYQCSNSQSAECMIQLEERQYMRNMICTINCLKLN*

>peptide 3 (56 aa)
MFTRCCRCDPLTTLQSLIDRSPDIHSRLHLYLEAAVTRASLPDQRRPVGALDKRNH*

>peptide 4 (44 aa)
MTCKMQISGVFHCSNTNICIVSSCGTIFFFDENAEPHYYHLQYI*

>peptide 5 (44 aa)
MSFYLLYMLIIFSCSVKSCHYSCSVQVSCTLPSRLPSWFASCHG*

>peptide 6 (71 aa)
MTPLLSAHSTPCSATAALHRRHAWPFRRCSIAGGQASPSSVSAVLRPPPVTVGDGVTRKAPQSRGAGRRCP*

>peptide 7 (93 aa)
RFQRFREPYPLPGRDDSAPRSSPLTSPRRYSMELSSAPVAPNTPPSPPPPCRPPHDAASLRPLHPMLCHRCTPSTTRMAVPSLLHRRRPGLPF*

>peptide 8 (31 aa)
MLLSLFLSIGRRCSSPLSSHGGSDPASLHWD*

>peptide 9 (29 aa)
MLCVLTVFNNRLTNVILSFIHAYYFFLLC*

>peptide 10 (41 aa)
MQNHTIIIYSISNCTFMCPSILFIGYSQVSITNVSTGTSSS*

>peptide 11 (38 aa)
MANSLAAGKPVSTKGMLFDSFVCKYSKSLIAFLGPVAI*

>peptide 12 (29 aa)
MSLQERAPLDDLANLSAMTLSSSKEGHGP*

>peptide 13 (29 aa)
MQVLQNYNIYLSFYIHTFAIVPLHVCNNA*

Sequence

>CNT30595978
CGATTCCAACGATTTAGGGAACCCTATCCTCTTCCCGGACGAGATGACTCTGCCCCGCGCTCCTCGCCGCTGACATCGCCGCGACGCTATTCCATGGAGC
TTTCATCCGCCCCCGTCGCTCCCAACACGCCGCCCTCCCCACCTCCGCCGTGCCGCCCTCCCCATGACGCCGCTTCTCTCCGCCCACTCCACCCCATGCT
CTGCCACCGCTGCACTCCATCGACGACACGCATGGCCGTTCCGTCGTTGCTCCATCGCAGGAGGCCAGGCCTCCCCTTCTAGCGTCTCAGCTGTTCTCCG
TCCACCACCCGTCACAGTTGGAGATGGGGTCACGAGGAAGGCCCCCCAGTCGAGAGGTGCCGGCCGCCGGTGTCCCTAGCCCACCATCATTGCCTGAATA
ATGGATCCTTTGCACTGGGAGAAGAAATGCTGCTCAGTCTTTTCCTCAGTATTGGGCGGCGTTGTTCCTCGCCATTGTCATCACATGGTGGCTCTGATCC
TGCGTCTCTTCACTGGGATTGAGAAAGATAAGAGGAGGTGAGCTGATCTAATTAGTGATGGCTTGTACATTCATTGGTAATGTTTACTCGCTGTTGCCGC
TGTGATCCTCTCACGACTCTGCAGTCTCTAATCGACCGGTCTCCTGATATCCACTCGCGTCTTCACCTCTATCTGGAGGCTGCAGTCACACGCGCCTCTC
TTCCTGATCAGCGGCGGCCGGTTGGTGCCCTTGACAAACGCAATCACTAATTGCGATGGCCACGACAAGTCCTCGACCGTGATGCTTTGCGTACTGACTG
TTTTCAATAATCGCCTAACCAATGTCATTTTATCTTTTATACATGCTTATTATTTTTTCTTGCTCTGTTAAAAGTTGCCATTACAGTTGCAGCGTGCAGG
TGTCTTGTACTTTGCCTTCTCGGTTACCTTCTTGGTTTGCTAGCTGCCATGGATAATTGGATATCCCAATCAGCAAATTTGTTGTTTTGTGTCATGATTG
AGTAGGCGAGAAACTGAAGTGAAGAGAATTTTTGGGTGAAAAATTGCAGAACTGCATGTCCTCTCTTGATCTATAGACAAATCGTTAATTGTGCTTGCAA
TGTGTTTTTAGAAATGGTTTAACATAGTTTGTTGCCATTATTGGTAACAAGCAACAGATACAAGGTAATAACCTTCGCCGCCACACGCTGCATCACACTC
TTGACCGAAAGTCGTGCCTCAAGATCGGTGGATGGCCAACAGCCTTGCTGCGGGCAAGCCAGTCTCCACGAAGGGCATGCTATTTGATTCTTTTGTGTGT
AAATATTCCAAAAGTTTGATTGCATTTTTAGGTCCAGTTGCCATATAAACCAATATACTTGCAAGTCAAAGATATATACTCCCTTTGATCATCAATATAT
GTATTTTTAACACTAATTTTAGTTTTACATACACCATATATTTATGTGGGGATTATATATATTGCATAGAAGATCTTTGGTACGCATTGACATCTTTTTT
CGTTGGTGAATGACATGCAAAATGCAAATTTCAGGGGTTTTCCATTGCTCAAATACCAATATATGCATTGTTTCAAGTTGTGGAACCATTTTTTTTTTTG
ACGAAAATGCAGAACCACACTATTATCATTTACAGTATATCTAATTGTACATTTATGTGTCCATCCATACTCTTTATAGGCTATTCTCAAGTCTCAATTA
CTAATGTCTCTACAGGAACGAGCTCCTCTTGATGATCTTGCTAATTTAAGTGCCATGACATTATCAAGCTCTAAGGAAGGCCATGGGCCATGACGATCTG
GGTAAGCAACATGACATTATCAAGGTGATAGTGGTCAGTACAGGGTAATCTTTTGATGAATGCAGGTGCTACAAAATTACAATATATATTTGTCTTTCTA
TATTCACACTTTTGCTATAGTGCCTCTGCATGTTTGTAACAACGCCTAAAAGGACAGGGAGAGGTTATGCAGATGAACTGAGGATAGTCAATTTTATATA
TTAATCAATTTAGTGTGTCTCTAGGATGGAATATATATGGCATGGAGACATAAGGTGATGGTGAGAACCGCTATAAAAGGTAGATATTTATTCTTATGAT
AAGCTTGTCAGAATCAATGGCATGCAACTGATCAGTTCAACTTCATGCATTTCGGATAGAAGAGAACATCTTAGAGTTAAACATGTATAGAACATAGTGT
GTTGATTGCCCATAAACAGCTAGCCCAACATTTGTCTGCTCCGCTAGCTATAATTTGGATCCTAACTTCAGTGTGAGATATATGGGCAGTTACAAGTTGA
ACTACTGATAGTTTACTAGAATGGCCTGTCATAACAAAGCTATAGTTACTTCTATGAATTTTGTGAAATAAAAGATGATCCATCTGTGACTTCCATTGTT
CAAGACTAAAAGAAATACAGATTGCAAGATCAAAAGGCAATAATGTGAGGCAGGGAGAAAAATACTTTTTCAGCACAGTTAGTCTGTGAGACTGTGACCA
TGTTTTCATCGGGAAACTCATTATAAAGAAATGAAATGGAAGCAGCTTTCCATGGTGATTTCATTGACCATTGCTCAGATCCAGGGCCGAATGATGTAGG
ATATCAATGCAGTAATTCACAAAGTGCAGAATGCATGATTCAGTTGGAGGAAAGGCAATACATGAGGAATATGATTTGTACAATAAATTGTCTTAAGTTA
AATTAATGCTCTTTTCTCATCTGGTGTTTTGTACCCTTGTAATACTCAAGCTGTTGTAATTCATCAGTTGAACCTTGTAGCAGTCTAGCAGAGCTTTAAA
TTTTGGCTCTCATCGGATGGCCTAATCAGCCAAAGAAAA