Detailed information on CNT30595975


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691875Oryza meridionalisOryza sativa98.9850.9998.19387forward
CNT30553102Oryza meridionalisOryza glaberrima98.9888.1598.19387forward
CNT3067165Oryza meridionalisLeersia perrieri94.88101.6484.64371forward
CNT30100753Oryza meridionalisOryza rufipogon98.9884.8798.19387forward
CNT30575871Oryza meridionalisOryza barthii94.8878.7798.11371forward

Expression of CNT30595975

Peptides detected in this lncRNA

>peptide 1 (40 aa)
AQKCNNCILTEGMGWYIYTVPYNNHLQASLARSKHKNEWA*

>peptide 2 (50 aa)
MHAMKTGIHYDTLSDVHLQVSEALTRCICALSRPYFFSRLNLGEGRSIRC*

Sequence

>CNT30595975
TAGCTCAAAAATGCAACAATTGTATATTGACAGAAGGAATGGGCTGGTATATTTACACTGTTCCATACAATAACCATTTGCAGGCTAGCTTAGCCAGGAG
CAAGCACAAGAATGAATGGGCATAGCTGCGATTTCTCCCTAGAGAAACTAAATTGCAGGTTAGCCAGGAGCTAACACATGCATGCCATGAAAACTGGAAT
ACACTACGATACTTTGTCGGACGTGCACTTGCAGGTTAGCGAGGCGCTAACGCGGTGCATATGTGCACTTTCACGACCTTATTTCTTTTCTCGTTTAAAT
TTGGGGGAGGGGAGGTCAATTAGGTGTTGACCTAGATTTCCCCCAGAGAGTATGGACAGTCTGATGGGTTCTTCACTTCTCGCAGAAGTCG