Detailed information on CNT30595932


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6ENB7|YCF68_ORYNI, E-value = 2e-67

BLAST vs NONCODE:
NONORUT005034, E-value = 4e-77

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30533065Oryza meridionalisEucalyptus grandis14.7525.9390.31196forward
CNT30402011Oryza meridionalisBeta vulgaris10.0822.8386.57134forward
CNT30712184Oryza meridionalisGlycine max37.5583.1790.98499forward
CNT30637537Oryza meridionalisCapsicum annuum11.4425.2984.87152forward
CNT30177674Oryza meridionalisSecale cereale22.514.7397.99299forward
CNT30221081Oryza meridionalisHordeum vulgare22.6514.8697.34301reverse complement
CNT30556102Oryza meridionalisOryza glaberrima20.9245.4299.64278forward
CNT30610339Oryza meridionalisGossypium raimondii10.3841.4491.3138reverse complement
CNT30714122Oryza meridionalisMalus domestica golden9.8631.7296.18131forward
CNT30627901Oryza meridionalisDaucus carota38.1543.3392.5507forward
CNT30720008Oryza meridionalisTriticum spelta15.8886.8398.1211reverse complement
CNT30479986Oryza meridionalisArabidopsis halleri7.0737.695.7494reverse complement
CNT30362263Oryza meridionalisSorghum bicolor30.747.1798.28408forward
CNT30646085Oryza meridionalisCannabis sativa11.2934.492150reverse complement
CNT3057391Oryza meridionalisAmborella trichopoda26.346.9384.86350forward
CNT30318962Oryza meridionalisAsparagus officinalis37.4723.8895.98498forward
CNT30148380Oryza meridionalisBrachypodium distachyon26.9426.497.49358forward
CNT30575742Oryza meridionalisOryza barthii27.3181.0397.8363forward
CNT30116753Oryza meridionalisOryza nivara8.227.1899.08109forward
CNT30726606Oryza meridionalisLupinus angustifolius37.7742.5891.04502forward

Expression of CNT30595932

Peptides detected in this lncRNA

>peptide 1 (35 aa)
WSLRKGKRISRSSFQEGRIREVLLIAAFSRPPGKA*

>peptide 2 (35 aa)
MSLVLLHPKXGGHGDVKKGILSLSTNLFRPRIISS*

>peptide 3 (39 aa)
MVRSLRHPRMKGXSRSSFQEGRIREVLLIAAFSRPPGKA*

>peptide 4 (39 aa)
MIHIFGSGADEHIELSMWLRALTAQAQRRNYQGRALPLS*

>peptide 5 (42 aa)
MSLVLLHPKRKKTSISKFSSDVAAFFLGVKQCQTKIPNKHKH*

>peptide 6 (69 aa)
MGSHLNRPIYPPEEKFVWFQTPIQTGGVRHANVPWMIHIFGSGADEHIELSMWLRXXXQEEYAMLMCLG*

Sequence

>CNT30595932
CCTGGTCCCTGCGGAAAGGAAAAAGAATTTCACGTTCTTCCTTTCAGGAAGGGAGGATTAGGGAAGTCCTATTGATTGCTGCTTTCTCCAGACCACCGGG
AAAAGCATGAAAAAAAGGCTCGAATGGTACGATCCCTCCGTCACCCCAGAATGAAAGGGGNTTCACGTTCTTCCTTTCAGGAAGGGAGGATTAGGGAAGT
CCTATTGATTGCTGCTTTCTCCAGACCGCCGGGAAAAGCATGAAAAAAAGGCTCGAATGGTACGATCCCTCCGTCACCCCAGAATGAAAGGGGTGATCTC
GTAGTTCTTGGTCTGTGAAGATGCGTTGTTAGGTGCTCCATTTTCCCATTGAGGACGAACCTCAACCTGTGCTCGAGAGATAGCTCTCCATACACTGATA
AGGGATGTATGGATTCTCGAGAAGAGAGGAGCCGTAGTGCCCCCCCCGGACCGCCCGGATCCCACGAGTGAATAGAAAGTTAGATCTACATGGGATCTCA
CCTGAATCGCCCCATCTATCCTCCTGAGGAGAAGTTTGTTTGGTTTCAAACTCCGATTCAAACAGGAGGAGTACGCCATGCTAATGTGCCTTGGATGATC
CACATCTTCGGGTCAGGCGCTGATGAGCACATTGAACTATCCATGTGGCTGAGAGCNNNNNNACAGGAGGAGTACGCCATGCTAATGTGCCTTGGATGAT
CCACATCTTCGGGTCAGGCGCTGATGAGCACATTGAACTATCCATGTGGCTGAGAGCCCTCACAGCCCAGGCACAACGACGCAATTATCAGGGGCGCGCT
CTACCACTGAGCTAATAGCCCGTCGCGCGGGCCTCCCTTTGGGAGGCCTGCTACGCCAAAAGCGAGAAAAACTCCATCCCTTTCCTTTTGACATCCCCAT
GCCGCCACACCACACGGGGGGGGGCATGGGGACGTCAAAAAGGGGATCCTATCACTATCAACTAATTTGTTCCGACCTAGGATAATAAGCTCATGAGCTT
GGTCTTACTTCACCCTAAANGGGGGGGGCATGGGGACGTCAAAAAGGGGATCCTATCACTATCAACTAATTTGTTCCGACCTAGGATAATAAGCTCATGA
GCTTGGTCTTACTTCACCCTAAACGAAAGAAGACTTCCATATCCAAGTTTAGCTCAGACGTAGCTGCCTTCTTTTTGGGCGTGAAGCAGTGTCAAACCAA
AATACCCAATAAGCATAAGCATTAGCTCTCCCTGAAAAGGAGGTGATCCAGCCGCACCTTCCAGTACGGCTACCTTGTTACGACTTCACTCCAGTCGCAA
GCCTAGCCTTAGGCATCCCCNTCCTTACG