Detailed information on CNT30595931


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT000252, E-value = 2e-79

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693210Oryza meridionalisOryza sativa35.6315.9196150reverse complement
CNT30577769Oryza meridionalisOryza barthii44.4244.5294.12187reverse complement

Expression of CNT30595931

Peptides detected in this lncRNA

>peptide 1 (67 aa)
MIHPPXVPEYSFQHVPYKSTKHEYKMIHPPCNKTHTCTEAAEAALAASALFVCLFRRTTLPNQVSSL*

>peptide 2 (30 aa)
PILWASPIKKQSQNINHNHFHNYIIITFQP*

Sequence

>CNT30595931
CCAATATTATGGGCCAGCCCAATTAAAAAGCAATCACAGAATATAAACCACAACCATTTTCATAATTATATTATAATCACATTCCAGCCATAATTAATTT
TTCAGCCCATACAAAAGCAAGTTCCAGAATACAGTTTCCAACATGTTCCATACAAAAGCACAAAACATGAATACAAAATGATCCATCCACCATNAGTTCC
AGAATACAGTTTCCAACATGTTCCATACAAAAGCACAAAACATGAATACAAAATGATCCATCCACCATGTAATAAGACACACACTTGTACTGAGGCTGCA
GAAGCAGCACTAGCTGCATCAGCTCTTTTCGTTTGCCTTTTTAGAAGAACCACCCTTCCGAATCAAGTGTCATCCTTGTAGGCAATGCACCCTCTACCAA
AGCATGTCTGTCATGACAGGT