Detailed information on CNT30595924


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30317088Oryza meridionalisCorylus avellana37.8125.0383.06183forward
CNT30375412Oryza meridionalisArabidopsis thaliana26.4518.6980.47128forward
CNT30616476Oryza meridionalisSesamum indicum39.0538.186.24189forward
CNT30552977Oryza meridionalisOryza glaberrima10072.2497.93484forward
CNT30132965Oryza meridionalisLolium perenne54.9657.9593.61266forward
CNT301476Oryza meridionalisZea mays20.4530.1895.9699forward
CNT30231426Oryza meridionalisAnanas comosus53.7233.1289.23260forward
CNT30345256Oryza meridionalisEragrostis tef58.0654.6792.53281forward
CNT30573153Oryza meridionalisVitis vinifera34.0926.1580.61165forward
CNT30148558Oryza meridionalisBrachypodium distachyon13.0225.9398.4163forward
CNT30113588Oryza meridionalisFicus carica41.9432.1785.71203forward

Expression of CNT30595924

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MSGTGPARRCGRSRRSRSCRWPRIGRRCAPARAGSGCRSPPRSPAACPG

>peptide 2 (43 aa)
GGNKYLVLDSSSSSVIRYTPHIVAINNKLIRQLDLHLHQLLAE*

>peptide 3 (28 aa)
MASYRSPLRSGTCWIRMQIPAEIPSRLSR

Sequence

>CNT30595924
GGAGGAAACAAATATCTTGTCCTCGATTCCTCTTCCTCATCAGTGATACGATACACACCGCACATTGTCGCAATTAACAATAAACTAATCAGGCAGCTCG
ATCTGCATCTCCATCAATTATTGGCAGAGTAGTAAACAGTAGCAATTGGAACTTGGCAGTGATGTACAACGCGGGTTGAGCTAGTTGGTGAAGTTGTTGA
GGCAGGTCGGGGATGCCCTTGAGGTAGAAGGTGTAGAAGATCTTGAAGGGGAAGACGATCTGGTTGAGCTTGACCTGGCCGTAGGCGCCCTCGAAGACGC
CGGAGCCGCCGGTGACGGCGAGGTACGACTCCTCGTATGTCAGGTACGGGCCCTGCACGGAGATGTGGCCGTAGTCGCCGAAGTAGAAGCTGTAGATGGC
CTCGTATCGGTCGCCGTTGCGCTCCGGCACGTGCTGGATCAGGATGCAGATCCCCGCCGAGATCCCCAGCCGCTTGTCCAGGCT