Detailed information on CNT30595889


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553271Oryza meridionalisOryza glaberrima78.1642.8896.72458forward
CNT30369888Oryza meridionalisOryza glumipatula78.1659.7196.51458forward
CNT30100659Oryza meridionalisOryza rufipogon40.7861.1396.65239reverse complement
CNT30575838Oryza meridionalisOryza barthii78.1631.4396.72458forward
CNT30116241Oryza meridionalisOryza nivara78.580.8496.52460forward

Expression of CNT30595889

Peptides detected in this lncRNA

>peptide 1 (45 aa)
MEDTDQELCPVAVEMMSSGKLKPCRQLLFYQDSLHRETSMKMVHV*

>peptide 2 (51 aa)
MTPSSLTSLLPEPRATLSISTTSPCKPHAHALTEAGLAPPASLLAATLVRD*

Sequence

>CNT30595889
ATGACCCCCTCCTCGCTCACCTCTCTCTTGCCTGAGCCAAGAGCTACACTTTCTATATCCACCACTTCACCGTGCAAACCCCATGCACACGCCTTGACAG
AAGCTGGGCTAGCTCCTCCTGCTTCCCTGCTAGCTGCTACTTTGGTTCGTGACTGAAAGCCAAATGGAAGATACGGATCAGGAGCTATGCCCCGTTGCGG
TGGAGATGATGAGTTCAGGAAAACTCAAACCATGTAGACAGTTGTTGTTCTATCAAGACTCCCTTCACCGAGAAACATCTATGAAAATGGTTCATGTTTA
GCAATAGTACGGTGTTATCCTAACTGAGCTTTTCTTCTAGCCACCATCCTCATCCTTCTTCAAAACCTCAACATCACTTTGTGTGGGAATTCAAAGGAAT
TGGTCTTCTTGACCTTGCAAGACCTTTTCTTGACCTTGTAAGACCCAACATCGTTGTGTTGCTTTTCTTGTTTCTTATTTTTCAATTTCATCTACCTCTT
CTTTCTACCTCCTATCTTTCTCTTAGTTCTTGCCTTCTCTTTCGGTCTATCCCTCCTGAGCTGTATTGATCACTTTCTATGTTATT