Detailed information on CNT30595877


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003607, E-value = 2e-40

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694558Oryza meridionalisOryza sativa17.0731.0385.12121forward
CNT30554546Oryza meridionalisOryza glaberrima24.8223.2288.07176forward
CNT30369837Oryza meridionalisOryza glumipatula33.158.9285.53235forward
CNT30101064Oryza meridionalisOryza rufipogon30.6185.7785.71217forward
CNT30578555Oryza meridionalisOryza barthii19.6162.3387.05139forward
CNT30116386Oryza meridionalisOryza nivara32.4416.0383.91230reverse complement

Expression of CNT30595877

Peptides detected in this lncRNA

>peptide 1 (68 aa)
MPNNGGIIGKPCRRRHQSAAVKASRSVKTWTAINDGVTNQPYRRGHQSAAMEAGRSVKIMSPSATAVV*

>peptide 2 (65 aa)
MSVSESLILGPDISFVIFLLMMAEVADVGTKSSINGNENTSQWRQKQAGGIDNEAHQWWRSPPTV*

>peptide 3 (32 aa)
MVEESANRIGGNTSRRRQRQAGSESEDPSTVV*

Sequence

>CNT30595877
TATCAATCTACTGATCCAGGGCTTGATACAGTCTAAACATGTCGGTTTCCGAATCATTAATTTTGGGACCCGACATTAGCTTTGTAATATTCCTCTTGAT
GATGGCAGAGGTGGCTGATGTGGGAACAAAGTCGTCCATCAATGGCAATGAAAACACCAGTCAGTGGCGGCAGAAGCAAGCCGGTGGTATAGATAATGAG
GCCCATCAATGGTGGAGGAGTCCGCCAACCGTATAGGCGGAAACACCAGTCGACGGCGACAGAGGCAAGCCGGCAGTGAAAGCGAAGACCCATCAACGGT
GGTGTGACCAACCAACCGTATAGGTGAGGACACCAGTCGGCGGCGACGAAGGCAGGCGGGTGGTGAAGTTGTAGATGCCTAACAATGGAGGCATAATTGG
CAAGCCGTGTAGACGAAGACACCAGTCAGCGGCGGTGAAGGCAAGCCGGTCGGTGAAGACGTGGACGGCCATAAACGATGGTGTGACCAACCAACCGTAT
AGGCGAGGACACCAGTCGGCGGCGATGGAGGCAGGCCGGTCGGTGAAGATAATGTCGCCATCAGCAACGGCGGTGGTGTAGACCAACCGTATAGGCGAAG
AAACCAGTCGGCGGCGAAAGCGGCTGGTTGGTGAAGTGACGGCCCTTGATGAATATATATGCGTAAATAGCTCCACATAGCGTACTCCGAGGCAGCTTGG
ATAAAAAAT