Detailed information on CNT30595771


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 1e-157

BLAST vs NONCODE:
NONMEST001181, E-value = 6e-125

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30225636Oryza meridionalisHordeum vulgare57.4372.2690.94607forward
CNT30242438Oryza meridionalisAvena sativa65.5674.5291.92693forward
CNT30458211Oryza meridionalisSaccharum spontaneum61.7877.2888.36653forward
CNT30583253Oryza meridionalisEchinochloa crusgalli65.8532.8588.79696forward

Expression of CNT30595771

Peptides detected in this lncRNA

>peptide 1 (52 aa)
MRRCWSGGMPSLSWILALTLSMVSEDSTSRVMVLPVRVFTKICMPPLRRRTR*

>peptide 2 (36 aa)
MSSQRSASARNNHQTDRVRTSTRLRTQQLIKQKTYNN

>peptide 3 (47 aa)
MRRCWSGGMPSLSWILALTLSMVSEDSTSRVIVLPVNVFTKICICKK*

>peptide 4 (40 aa)
MVSELSTSRVMVFPVRVLTKICIPPRRRSTRWRVDSFWML*

Sequence

>CNT30595771
GACGATTTAATATGCATCATTTTCAAACTTGCAACTCAGATAAAACATCGACAGGAATGAGATGCAAATGAGCAAATTGAGCACATATTTAAGTTCAAAT
CCAACTTATTCATAAAGCATACTGCAGTCCCACAGGAAACTGTTTCATAAAACTAACATATCATACGGACTCGATGGTCCATTAAACCAGACACAAGTAG
ACATCAGCACCACAAATACTTGACGAACAGAGGCTCGGGACGAACAGGCACAGCGGCAGCTCCACCAAACTGGCTGATTACTGACCACCACGGAGGCGGA
GCACCAGGTGGAGGGTAGACTCCTTCTGGATGTTGTAGTCGGCGAGGGTGCGGCCATCCTCGAGCTGCTTGCCAGCAAAGATCAGACGCTGCTGGTCAGG
GGGAATCCCCTCCTTGTCCTGGATCTTGGCCTTCACATTGTCGATGGTGTCTGAGCTCTCAACCTCCAGGGTGATGGTCTTCCCTGTGAGGGTCTTGACA
AAGATCTGCATACCACCACGAAGGCGGAGCACAAGGTGGAGGGTGGACTCCTTCTGGATGTTGTAGTCAGCAAGGGTCCTGCCATCCTCCAGCTGCTTGC
CAGCAAAGATGAGGCGCTGCTGGTCCGGGGGAATGCCCTCCTTGTCCTGGATCTTGGCCTTGACATTGTCAATGGTATCAGAAGACTCCACCTCGAGGGT
GATGGTCTTGCCGGTCAGAGTCTTCACGAAGATCTGCATGCCTCCCCTGAGACGGAGGACAAGGTGAAGGGTCGACTCCTTCTGGATGTTGTAGTCAGCA
AGGGTCCTGCCGTCCTCCAGCTGCTTGCCAGCGAAAATGAGACGCTGCTGGTCCGGGGGGATGCCCTCCTTATCTTGGATCTTAGCCTTGACATTATCAA
TGGTGTCAGAAGACTCCACCTCGAGGGTGATAGTCTTGCCGGTCAATGTCTTCACAAAGATCTGCATCTGCAAGAAATAATCACCAAACAGATAGGGTAA
GAACTAGCACAAGATTAAGGACACAACAACTGATCAAACAGAAAACATATAACAACA