Detailed information on CNT30595715


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691387Oryza meridionalisOryza sativa60.4718.0697.67858forward
CNT30107393Oryza meridionalisOryza longistaminata43.5544.5697.57618forward
CNT30100463Oryza meridionalisOryza rufipogon43.0656.4797.22611forward
CNT30575447Oryza meridionalisOryza barthii74.1446.2698.291052forward
CNT30603681Oryza meridionalisOryza punctata41.0940.7489.54583forward

Expression of CNT30595715

Peptides detected in this lncRNA

>peptide 1 (86 aa)
SMDRGQLRYHFAGSDMCRGFCFASTATCRATARHGLATRARGRAPSSRRVRRPDPAHSPPPFEPPSPAPPRATARRSRADLVNSPP*

>peptide 2 (62 aa)
IDGSRPAQISLRRERHVSRLLLRFHGHMPRHGAPRSRHSRARARAVLTPRPPPRSGALSSPF*

>peptide 3 (73 aa)
MPFSASSRRPLPSTVPVRRARGFSDSCKGTVTSLWQQLHILQENFWVFQTIPMIFLQVVQLLSQACCLPLPKL*

>peptide 4 (36 aa)
MVLLNLLINKNVFISMDASATRQWQMNSSTYEHLAR*

>peptide 5 (49 aa)
MQGDGDKLVAATAHLARKLLGFSDHTDDFLASCAVVVSSLLPPFAKTIK*

>peptide 6 (74 aa)
MKIVPSVLIMKAAHVNCLVHPDHLLLFTLIRLRRLYIVYWLPLLNVSLIAHDMLAWKGSFELIMRPVTILSSEL*

>peptide 7 (82 aa)
DRWIAASSDITSPGATCVAAFASLPRPHAAPRRATVSPLARAGARRPHAASAAQIRRTLLPLLSRHRRHRRARRRGAAAPIS*

Sequence

>CNT30595715
GATCGATGGATCGCGGCCAGCTCAGATATCACTTCGCCGGGAGCGACATGTGTCGCGGCTTTTGCTTCGCTTCCACGGCCACATGCCGCGCCACGGCGCG
CCACGGTCTCGCCACTCGCGCGCGCGGGCGCGCGCCGTCCTCACGCCGCGTCCGCCGCCCAGATCCGGCGCACTCTCCTCCCCCTTTTGAGCCGCCATCG
CCGGCACCGCCGCGCGCGACGGCGCGGCGCAGCCGCGCCGATCTCGTGAATTCCCCTCCCTGACCACTCTCCCGGCCCCGGCCACCACCCAAATCGCAAT
GCCTTTCTCCGCTAGCTCCCGCCGTCCCCTCCCCTCGACGGTGCCGGTGCGGCGCGCGCGTGGTTTCTCAGATTCATGCAAGGGGACGGTGACAAGCTTG
TGGCAGCAACTGCACATCTTGCAAGAAAACTTTTGGGTTTTTCAGACCATACCGATGATTTTCTTGCAAGTTGTGCAGTTGTTGTCTCAAGCTTGCTGCC
TCCCTTTGCCAAAACTATAAAGTGAGAAAGCAGGGTAGAGTTATTCAATTACAGGCACACAAGACAAAATTAAAGTAATAAACATGTCTGACCAACAAAC
ACAATGATTAATAACAAAACTCTTGTGGCATGAGATAATATTGAAGCATGATGCTTACAACAGTTATAATATGAAAACTAAATGTAGGCAGGTATATGTT
TTGACAATGTTGACATTATCTTAATGGTTCTTCTAAATCTTTTGATTAACAAAAATGTATTTATTTCCATGGATGCTAGTGCCACCAGGCAATGGCAAAT
GAACTCATCAACATATGAACATCTAGCAAGGTGAGTAAAGTCTGGTAAGGTGCTAGATGAGTAAAGTCTGGTAAGGAAGTCAAACATCTAATATGTATGA
AAATTGTTCCTAGTGTTCTTATAATGAAGGCTGCACATGTAAACTGTTTAGTCCATCCTGATCATCTATTGTTGTTTACTCTGATCAGGTTACGTCGTCT
CTACATTGTGTATTGGCTTCCACTGCTGAATGTTTCTCTTATTGCCCATGACATGCTTGCTTGGAAGGGCAGTTTTGAGTTGATCATGAGGCCAGTCACA
ATTCTTAGCAGTGAACTATGAATTTCTAAATGCATTATGTTAGTTTCATGGCTTGATCCTTGTTTCTTTGTTTTGTAGGTTTGCAGGAATTTCTCTAGGA
ATGCCCAGTGAGTGATCCTGTAAATTTTGGAGTTGATTGTTCATCAGAATAGCACTATAATTTTCCTGTCATCTGTGCTTTGGTAGCGGAACGTTCATTG
CCCCATGCTACTCAGCTTTGTACTTCTGTAAATCAAATGAGATTGAATAATATATGTTTACTTTTGGAAGGAAAAAGATGTATGACTGTTCTCAAGCAAA
TGAAAAATTCCAGTTTTTG