Detailed information on CNT30595706


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9FKL6|CB60B_ARATH, E-value = 7e-28

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690910Oryza meridionalisOryza sativa72.3762.6598.35364forward
CNT30520035Oryza meridionalisSetaria italica63.6248.7182.19320forward
CNT30131847Oryza meridionalisLolium perenne38.1728.8783.33192forward
CNT30364586Oryza meridionalisSorghum bicolor22.8619.9793.04115forward

Expression of CNT30595706

Peptides detected in this lncRNA

>peptide 1 (80 aa)
LLDQQLGCLLVLELNKLSSSLGRFLPDKDAPAHSCLDLEPPDDSFPRLVDAPPMLKIRNICCISSFSNISWLRILISSIR*

>peptide 2 (32 aa)
MLLLWWSQCQHIGAPRNWILQCGTIELAFRCQ*

>peptide 3 (46 aa)
MPQRIAALILSHPTTAFPGWLTRHPCSKSATSVASLRSPISRGSAS*

Sequence

>CNT30595706
CTTTGTTAGACCAGCAGTTAGGATGTTTGCTAGTCCTCGAGCTCAACAAGCTGAGCTCTTCTCTCGGCCGCTTTCTTCCTGACAAAGATGCCCCAGCGCA
TAGCTGCCTTGATCTTGAGCCACCCGACGACAGCTTTCCCAGGTTGGTTGACGCGCCACCCATGCTCAAAATCCGCAACATCTGTTGCATCTCTTCGTTC
TCCAATATCTCGTGGCTCCGCATCCTGATCTCCTCCATCAGGTAGTCGTCAACCCCACTCCGGTTCTCCTGCGGCTGCGACCAGTCGTCGAAAGGATTCA
AGCCGGTGGGCTGCATGGACTGGCCACCTAGTGCTGCGAATTCAAAATTTTGCTGATGTTGTTGCTGTGGTGGTCCCAATGCCAGCATATTGGAGCCCCT
AGAAACTGGATTCTGCAGTGCGGAACCATTGAACTGGCTTTCAGGTGTCAGTGAACTCCGCTCATACTGTGTAGTGACGTTTGCAGGTATGCTTTGAGAA
TTG