Detailed information on CNT30595697


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694665Oryza meridionalisOryza sativa20.1327.1488.4295forward
CNT30670880Oryza meridionalisSetaria viridis12.9228.595.0861forward
CNT30552718Oryza meridionalisOryza glaberrima48.9425.999.57231forward
CNT30139418Oryza meridionalisLolium perenne20.768.7788.7898forward
CNT309611Oryza meridionalisZea mays18.8622.5393.2689forward
CNT30575127Oryza meridionalisOryza barthii48.9418.4999.57231forward
CNT30583774Oryza meridionalisEchinochloa crusgalli20.135.5789.4795forward

Expression of CNT30595697

Peptides detected in this lncRNA

>peptide 1 (57 aa)
MYGDDDSTAAAVRTCCYTRRRPCCPRARRRCTPWPRAMSPWRRAAAWWRRGGARRACP

>peptide 2 (56 aa)
MVMMIPQQQQLELVVIPEDALVVLGLDVDALLGLAPCRLGDGLRHGGEEVVRDVRVR

>peptide 3 (28 aa)
MHSLASRHVALATGCGMVEKRWCATCVSV

>peptide 4 (35 aa)
GKKTMEITRQGPRLRHRSSAADTYIDYKSTGMTHA*

Sequence

>CNT30595697
GGGAAAAAAACGATGGAAATAACACGACAGGGACCAAGGCTGCGACACCGGAGCTCAGCAGCTGACACATACATAGACTACAAATCCACAGGCATGACAC
ACGCCTGATCCGCCTACTTTGCACTTGATGGCAACTCTAGCAATGGCACTGCAATAGCCTTCCTCTGTGCCCAAGTGCCCCTCTCCTATCTAAAGAGACT
AACCATAGATAGATGCATGGATAGATAGACGATTGTTCATGACACTATCTTCTCTTCCCTTGTAATCTTTCTTCTTCAAATTGTTGCTGCTTGGCAATGT
ATGGTGATGATGATTCCACAGCAGCAGCAGTTAGAACTTGTTGTTATACCAGAAGACGCCCTTGTTGTCCTCGGGCTCGACGTAGATGCACTCCTTGGCC
TCGCGCCATGTCGCCTTGGCGACGGGCTGCGGCATGGTGGAGAAGAGGTGGTGCGCGACGTGCGTGTCCGTG