Detailed information on CNT30595654


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SK39|SBP3_ARATH, E-value = 5e-29

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691502Oryza meridionalisOryza sativa38.6359.3295.58226forward
CNT30671312Oryza meridionalisSetaria viridis15.928.3594.6293forward
CNT30519660Oryza meridionalisSetaria italica44.6239.0195.02261forward
CNT30552636Oryza meridionalisOryza glaberrima54.8758.0595.95321forward
CNT30442397Oryza meridionalisAegilops tauschii27.0115.9495.57158forward
CNT30667282Oryza meridionalisTriticum dicoccoides18.9724.9494.59111forward
CNT30686589Oryza meridionalisTriticum urartu27.0116.1294.94158forward
CNT30364531Oryza meridionalisSorghum bicolor29.2353.4494.74171forward
CNT30369561Oryza meridionalisOryza glumipatula90.7786.7696.99531forward
CNT30100122Oryza meridionalisOryza rufipogon85.387.3997.19499forward

Expression of CNT30595654

Peptides detected in this lncRNA

>peptide 1 (39 aa)
DNPILKSLPRFLIIQIIVQLIKQPESKAASTDTLTHREK*

>peptide 2 (50 aa)
MGRCRRTPAAAPPSAPPPSLSPRGVCGSVEGCCWVVASGEVKRWRKRRCAH

Sequence

>CNT30595654
CAGACAATCCAATACTTAAATCACTCCCCAGATTTCTTATTATTCAGATTATTGTGCAGCTAATCAAGCAACCAGAGAGCAAAGCTGCAAGCACAGACAC
ACTGACACACAGGGAGAAGTAATAATAGGTTACACATGGAATTACGGATGTAATTAAGCTGTAGAGCACAAGAGGATACAATAATCTAAGGGTTGATTTG
GGGGAGGGGGGATTTTTTTTTTTTCATTCGGTGAGGCGGGCGACGACGGGGTACTTGGCCTGGAACTTGGTCTCCCAGTCGGCGAGGACGGCGAGCTCCT
TGTCGGAGAGGCCGGAGAGGTCGCCGGAGACGTCGGCGTCGTCCTTGGACATCTTGCCGAGCGCGCGGCTGGCCTCGCGGCCGGCGAAGACGGCGTAGAC
CTTGCCGCGGACGGAGACGTAGATCGGCTTCGATGGGTCGCTGCCGTCGTACGCCCGCAGCTGCGCCGCCGTCAGCTCCGCCGCCATCTCTCTCTCCTCG
CGGTGTGTGTGGATCAGTGGAAGGTTGTTGTTGGGTTGTGGCTAGTGGAGAAGTGAAGCGGTGGAGAAAAAGGCGATGCGCCCAT