Detailed information on CNT30595636


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30189005Oryza meridionalisSecale cereale28.3437.2984.08157forward
CNT30107024Oryza meridionalisOryza longistaminata12.6424.4888.5770reverse complement
CNT30578513Oryza meridionalisOryza barthii20.7636.7493.91115reverse complement

Expression of CNT30595636

Peptides detected in this lncRNA

>peptide 1 (52 aa)
MIVWLHLLKGNSFCKLRIRTSSIIFKISSVEMLISKLRRSGRRRGTSRARRR*

>peptide 2 (68 aa)
MKKKGPAGVERVVSSMNYIKNKLRTKMGKKKYLNDCLVTFIEREFFLQAKDKDIIDYFQNIKRRNVNL*

>peptide 3 (58 aa)
RPSAERAAARWRLGVAGSSEAATDRAPARRAVACVPVWRAGSAPSLPPLPAFHGFADD*

>peptide 4 (85 aa)
AVGRAGSGALATRRRRLQRGSDGPRARAACCGLCARVACRLGAQPSSPSRLPRFRRRLRLRRRRRATPPPHCHKLKHEEEGSCWC*

>peptide 5 (77 aa)
GRRPSGQRRAGDSASPAPARQRRTARPRGVLWPVCPCGVPARRPAFLPFPPSTVSPTTEAAKTPTGHAATTLPQIET*

Sequence

>CNT30595636
CGGCCGTCGGCCGAGCGGGCAGCGGCGCGCTGGCGACTCGGCGTCGCCGGCTCCAGCGAGGCAGCGACGGACCGCGCGCCCGCGCGGCGTGCTGTGGCCT
GTGTGCCCGTGTGGCGTGCCGGCTCGGCGCCCAGCCTTCCTCCCCTTCCCGCCTTCCACGGTTTCGCCGACGACTGAGGCTGCGAAGACGCCGACGGGCC
ACGCCGCCACCACACTGCCACAAATTGAAACATGAAGAAGAAGGGTCCTGCTGGTGTTGAGAGGGTCGTTTCTTCAATGAACTACATCAAAAACAAGTTG
AGAACCAAGATGGGAAAAAAAAAATACTTGAATGATTGTTTGGTTACATTTATTGAAAGGGAATTCTTTTTGCAAGCTAAGGATAAGGACATCATCGATT
ATTTTCAAAATATCAAGCGTCGAAATGTTAATCTCTAAATTGCGTAGGAGCGGGCGAAGAAGAGGAACATCGCGAGCGCGACGGCGCTGACGCCGGCGAG
CAGCCAGTAGAAGTAGTCGAGGTGGCCGCGGTCGAGGTCGTCAGCGAACCACCC