Detailed information on CNT30595628


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0JR25|IBBR_ORYSJ, E-value = 2e-21

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30689948Oryza meridionalisOryza sativa16.0730.3989.5386forward
CNT30552066Oryza meridionalisOryza glaberrima83.3638.7297.53446forward
CNT3099556Oryza meridionalisOryza rufipogon16.0733.5989.5386forward
CNT30574713Oryza meridionalisOryza barthii17.5727.1788.394forward
CNT30603558Oryza meridionalisOryza punctata94.5860.6784.98506forward

Expression of CNT30595628

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MKRGGADDSTMSHSLQAAAHCFTSSLQRHRGG*

>peptide 2 (38 aa)
MFVTHDITLTCIPTPKPHDRQHTELYTHVRTYVRIRTS*

Sequence

>CNT30595628
CGTCGATATTCAAATTAGCTATTTGCTATAATACCCCTCCCTGTGGATAGTGGATATCGATAGACGAATAGATATCTCATTCGTCTCTTATTTATCACGA
TATGTTCGTAACACATGACATAACATTAACATGCATACCAACACCCAAACCACACGATAGACAACACACGGAATTGTACACACACGTACGTACGTATGTA
CGAATACGAACAAGCTAGAACACACATAGATTGATCGTTCGATCGATCGAACGACGCGAACAATCAGCTATATACATATAGCGCGCGCGTACGCTTAATT
TTATTGGTGAAAGGATCAATCTCAGCTATAGTTAATTAGTTCATGCGCACTTGGGACCTGGCTCGCCGGTGAAGTGGTCGCGGCAGATGAAGCGAGGCGG
CGCCGACGACTCCACCATGTCGCACTCCTTGCAGGCGGCGGCGCACTGCTTCACCTCGTCGTTGCAACGCCACCGCGGCGGGTAGATCTTGAGCACGGAC
ATCTCGATGTTGTCGCAGCACTCCCACGGTCTGGA