Detailed information on CNT30595589


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369403Oryza meridionalisOryza glumipatula85.0959.0698.71388forward
CNT3099473Oryza meridionalisOryza rufipogon83.9910098.43383forward
CNT30575061Oryza meridionalisOryza barthii98.4649.3998.66449forward
CNT30117026Oryza meridionalisOryza nivara23.2515.7798.11106forward

Expression of CNT30595589

Peptides detected in this lncRNA

>peptide 1 (64 aa)
MSSASCCSSSSYSPSSSAVASWYCWYSETRSRPWRGLSVECHRHWTSHCWGSTRRSRTSSCSGH*

>peptide 2 (33 aa)
RLSFLVICKYCTRGSTRKGKIHPKYQQSQTSIK*

Sequence

>CNT30595589
CGATTATCATTCCTTGTAATTTGCAAATATTGCACACGAGGATCAACGCGGAAAGGTAAAATTCATCCGAAATATCAACAATCGCAGACCAGCATCAAGT
AATACAGTACCCAAAAAGGTTCCCATAGCACAGACGAAAATACAAAGCGAAGACATAGGAAGCGGGCGGTGGCGTACGAGGCGGTAATACGGTGATAATG
TAGACGGAAACACCAAGCACACGAAACCCTGCCCTAGAACCACCAAGCAAAGCCACCTTACATGTCGTCAGCCTCCTGCTGCTCCTCGTCCTCGTACTCG
CCCTCCTCATCGGCGGTGGCATCCTGGTACTGCTGGTACTCAGAGACAAGGTCGAGGCCATGGAGAGGCCTCTCGGTGGAATGTCACAGACACTGGACTT
CACATTGTTGGGGATCCACTCGACGAAGTAGGACGAGTTCTTGTTCTGGACATTGA