Detailed information on CNT30595576


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552441Oryza meridionalisOryza glaberrima54.3927.4397.7217forward
CNT30369353Oryza meridionalisOryza glumipatula54.3928.2997.7217forward
CNT30575075Oryza meridionalisOryza barthii54.3929.1797.7217forward

Expression of CNT30595576

Peptides detected in this lncRNA

>peptide 1 (29 aa)
NNSSCLLLCNAGLPRPGSFDTDAEMERRV*

>peptide 2 (32 aa)
MVKLYQSVVWYIGLAWHSSSSTSPGVGAQPNSF

>peptide 3 (35 aa)
MICNILLTWMRREISCIIYGQTVSICCMVYRACLA*

>peptide 4 (38 aa)
TTHPVCSSVMQVSQDQGVLTQMLRWREEFRTNTCQAIS*

>peptide 5 (35 aa)
MAVTVDSSSHFARMRSEVFWKSLGAVFWKIGLVST*

Sequence

>CNT30595576
AACAACTCATCCTGTTTGCTCCTCTGTAATGCAGGTCTCCCAAGACCAGGGAGTTTTGACACAGATGCTGAGATGGAGAGAAGAGTTTAGAACCAACACA
TGCCAAGCAATTAGCTGAAAGAGAAGGCCGTGGCTACAAAATGGCTGTTACTGTAGATTCTTCGTCACATTTTGCTAGGATGAGAAGTGAGGTGTTCTGG
AAATCTTTGGGCGCAGTTTTTTGGAAGATAGGACTCGTGTCTACATGATATGCAATATTCTGCTGACATGGATGAGGAGAGAAATTTCATGCATAATATA
TGGTCAAACTGTATCAATCTGTTGTATGGTATATAGGGCTTGCTTGGCATAGCTCCAGCTCCACCTCTCCTGGAGTTGGAGCTCAACCAAACAGTTTCA