Detailed information on CNT30595550


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696336Oryza meridionalisOryza sativa59.0957.0598.35182forward
CNT30100635Oryza meridionalisOryza rufipogon100.6514.6196.77310forward
CNT30575741Oryza meridionalisOryza barthii100.3223.1397.09309forward

Expression of CNT30595550

Peptides detected in this lncRNA

>peptide 1 (36 aa)
SFTKVVQCSICFRFSPNPLKVSTSAFRTLAAAIRHA*

>peptide 2 (47 aa)
MRDLANQRPLVPISCCFHSTSSVTPHLNLRDTVGGLKLLENQCTSLS*

Sequence

>CNT30595550
GATCTTTCACTAAGGTGGTCCAGTGCTCGATCTGCTTCAGGTTTAGTCCTAATCCCCTGAAGGTCTCAACGTCTGCTTTCAGAACGTTGGCAGCAGCGAT
CCGCCATGCGTGACCTCGCCAATCAAAGACCTCTTGTGCCCATATCCTGTTGTTTCCATTCAACGTCCTCAGTAACTCCTCATCTGAATTTAAGAGACAC
AGTTGGAGGCTTGAAGCTGCTAGAAAACCAGTGTACATCCTTGAGCTGACTAACAAGTGAGTCTTCCTAGCTCAACAAATAGGCTTATGCTTTTCGTCGG
AGTGCATA