Detailed information on CNT30595500


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6I544|GL52_ORYSJ, E-value = 2e-43

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672592Oryza meridionalisSetaria viridis15.5234.6287.8899forward
CNT30618191Oryza meridionalisSesamum indicum27.5913.5689.77176forward
CNT30552278Oryza meridionalisOryza glaberrima50.9436.8599.08325forward
CNT30661706Oryza meridionalisTriticum dicoccoides33.8633.3382.87216forward
CNT30339207Oryza meridionalisEragrostis tef10.1930.6690.7765forward
CNT30369486Oryza meridionalisOryza glumipatula34.4824.86100220forward
CNT3099918Oryza meridionalisOryza rufipogon56.4356.5199.17360forward
CNT30574949Oryza meridionalisOryza barthii52.3548.1399.1334forward
CNT30117848Oryza meridionalisOryza nivara35.4231.09100226forward

Expression of CNT30595500

Peptides detected in this lncRNA

>peptide 1 (50 aa)
MRARETPRVLSPGTFSTLAPVTTAPVVVLAAAPGLASTPEKKSATQMSWR*

Sequence

>CNT30595500
GAAACTTTTAATCTCTCTCCATATGTATCGGGTCGTCGTCTGATACCGCCTAGGTCTTCTTGGGGGCAAACTTGGCCTTGATCTTGTCCACCTCCTCGTC
GTCGATCTGGAAGGCCTTGGCGAGGACGGCGCCGCGGGGGAAGACGAAGACGTCGCCCTGGGAGATGGTGCGGGAGAGGAGCTTGTTGGCGGTGGTGACG
AAGCCGACGTCGAGCTCGCCGTAGAGGACGAAGACGACCTCGGTGGCGCGCGGGTGGGTGTGCGGCGGGTTGAGGCCGCCGGGGGCGTAGTCGATGCGGG
CGAGGGAGACGCCGAGGGTGTTGAGCCCCGGGACCTTCTCGACGTTGGCGCCGGTGACGACGGCGCCGGTGGTGGTGTTGGCGGCGGCGCCGGGGCTGGC
GAGCACGCCGGAGAAGAAGTCGGCGACGCAGATGTCCTGGAGGTAGTCCGGGTCGCCGGCGAGCGACGGCGCCGCGGCGACGGCGAGCGCCACCGCCACC
GCTCCGAGGAGCAGAGAGGACCACGACGACCCTGCAGCCCCAGCCATCCTGCTCGCTGATCTCTCTCGCCTGCTAGCTGCGCCTCTGCTCTTCTTCTGCT
CGCCGATGGTTAATTGATTGATGTGTGTTGACCACTTG